CTDSPL Antibody


Immunocytochemistry/ Immunofluorescence: CTDSPL Antibody [NBP2-31913] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: CTDSPL Antibody [NBP2-31913] - Staining of human lung shows moderate membranous positivity in pneumocytes.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

CTDSPL Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: AIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKGDQ
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CTDSPL Protein (NBP2-31913PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CTDSPL Antibody

  • C3orf8
  • Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 3
  • CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) smallphosphatase-like
  • CTD small phosphatase-like protein
  • CTDSP-like
  • EC 3.1.3
  • HYA22
  • NIF1
  • NIFL
  • NIF-like protein
  • NLI-interacting factor 1
  • Nuclear LIM interactor-interacting factor 1
  • Protein YA22
  • PSR1
  • RB protein serine phosphatase from chromosome 3
  • SCP3chromosome 3 open reading frame 8
  • Small CTD phosphatase 3
  • Small C-terminal domain phosphatase 3
  • YA22


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB, Simple Western, ICC
Species: Mu
Applications: WB, Simple Western, ICC
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC-P

Publications for CTDSPL Antibody (NBP2-31913) (0)

There are no publications for CTDSPL Antibody (NBP2-31913).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CTDSPL Antibody (NBP2-31913) (0)

There are no reviews for CTDSPL Antibody (NBP2-31913). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CTDSPL Antibody (NBP2-31913) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CTDSPL Products

Bioinformatics Tool for CTDSPL Antibody (NBP2-31913)

Discover related pathways, diseases and genes to CTDSPL Antibody (NBP2-31913). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CTDSPL Antibody (NBP2-31913)

Discover more about diseases related to CTDSPL Antibody (NBP2-31913).

Pathways for CTDSPL Antibody (NBP2-31913)

View related products by pathway.

PTMs for CTDSPL Antibody (NBP2-31913)

Learn more about PTMs related to CTDSPL Antibody (NBP2-31913).

Blogs on CTDSPL

There are no specific blogs for CTDSPL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CTDSPL Antibody and receive a gift card or discount.


Gene Symbol CTDSPL