CTDSP2 Antibody - BSA Free

Western Blot: CTDSP2 Antibody [NBP1-56566] - RPMI 8226 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CTDSP2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CTDSP2(CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 2) The peptide sequence was selected from the middle region of CTDSP2. Peptide sequence ASYIFHPENAVPVQSWFDDMADTELLNLIPIFEELSGAEDVYTSLGQLRA The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CTDSP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CTDSP2 Antibody - BSA Free

• carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2
• conserved gene amplified in osteosarcoma
• CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) smallphosphatase 2
• NIF2
• Nuclear LIM interactor-interacting factor 2
• OS4NLI-interacting factor 2
• Protein OS-4
• PSR2
• SCP2EC 3.1.3.16
• Small CTD phosphatase 2
• Small C-terminal domain phosphatase 2

Background

CTDSP2 preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residues repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A.CTDSP2 negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation. CTDSP2 is recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells.CTDSP2 may contribute to the development of sarcomas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CTDSP2
• Uniprot:
  • O14595(Human)