Recombinant Human CSRP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CSRP1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-99 of Human CSRP1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CSRP1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CSRP1 Protein

  • CRP
  • CRP1
  • CSRP1
  • CSRPCYRP
  • CYRP
  • cysteine and glycine-rich protein 1
  • Cysteine-rich protein 1
  • D1S181E
  • DKFZp686M148
  • LIM-domain protein

Background

CSRP1 - cysteine and glycine-rich protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF4409
Species: Mu
Applications: WB
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for CSRP1 Partial Recombinant Protein (H00001465-Q01) (0)

There are no publications for CSRP1 Partial Recombinant Protein (H00001465-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CSRP1 Partial Recombinant Protein (H00001465-Q01) (0)

There are no reviews for CSRP1 Partial Recombinant Protein (H00001465-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CSRP1 Partial Recombinant Protein (H00001465-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CSRP1 Products

Bioinformatics Tool for CSRP1 Partial Recombinant Protein (H00001465-Q01)

Discover related pathways, diseases and genes to CSRP1 Partial Recombinant Protein (H00001465-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CSRP1 Partial Recombinant Protein (H00001465-Q01)

Discover more about diseases related to CSRP1 Partial Recombinant Protein (H00001465-Q01).
 

Pathways for CSRP1 Partial Recombinant Protein (H00001465-Q01)

View related products by pathway.

PTMs for CSRP1 Partial Recombinant Protein (H00001465-Q01)

Learn more about PTMs related to CSRP1 Partial Recombinant Protein (H00001465-Q01).

Blogs on CSRP1

There are no specific blogs for CSRP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CSRP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CSRP1
Entrez