CSDE1 Antibody [DyLight 680]

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: DyLight 680

CSDE1 Antibody [DyLight 680] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 369-600 of human CSDE1 (NP_009089.4).
  
  Sequence:
  LSAQRNHAIRIKKLPKGTVSFHSHSDHRFLGTVEKEATFSNPKTTSPNKGKEKEAEDGIIAYDDCGVKLTIAFQAKDVEGSTSPQIGDKVEFSISDKQRPGQQVATCVRLLGRNSNSKRLLGYVATLKDNFGFIETANHDKEIFFHYSEFSGDVDSLELGDMVEYSLSKGKGNKVSAEKVNKTHSVNGITEEADPTIYSGKVIRPLRSVDPTQTEYQGMIEIVEEGDMKGEV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CSDE1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunoprecipitation
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for CSDE1 Antibody [DyLight 680]

• cold shock domain containing E1, RNA-binding
• cold shock domain-containing protein E1
• D1S155EUNRRP5-1000E10.3
• DKFZp779B0247
• DKFZp779J1455
• FLJ26882
• KIAA0885
• N-ras upstream gene protein
• NRAS-related
• NRU
• Protein UNR
• upstream of NRAS

Background

CSDE1, also known as Cold shock domain-containing protein E1, is a 798 amino acid long isoform that is 89 kDa and a short 767 amino acid isoform that is approx. 86 kDa, which is directly related to the translation of the human rhinovirus RNA as an RNA binding protein. Studies are being performed on the relationship of this protein to chronic lymphocytic leukemia, diamond-blackfan anemia, lymphocytic leukemia, breast cancer, and shock. CSDE1 protein involvement has been observed with relation to PCSK7, SYNCRIP, PABPC1, HNRNPD, PIK3R1 in the regulation of transcription DNA-dependent and male gonad development pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CSDE1