CRY2 Antibody - BSA Free

Western Blot: CRY2 Antibody [NBP3-38346] - Western blot analysis of various lysates using CRY2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 180s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CRY2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CRY2 Antibody - BSA Free (NBP3-38346) is a polyclonal antibody validated for use in WB, ELISA and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human CRY2 (NP_066940.3).
  
  Sequence:
  MAATVATAAAVAPAPAPGTDSASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDETYGVPSLEELGFPTEGLGPAVWQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CRY2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Simple Western 1:100 - 1:1000
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 67 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for CRY2 Antibody - BSA Free

• CRY2
• cryptochrome 2 (photolyase-like)
• cryptochrome-2
• FLJ10332
• growth-inhibiting protein 37
• HCRY2
• KIAA0658
• PHLL2

Background

Blue light-dependent regulator of the circadian feedback loop. Inhibits CLOCK NPAS2-ARNTL E box-mediatedtranscription. Acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. Has nophotolyase activity. Capable of translocating circadian clock core proteins such as PER proteins to the nucleus. Mayinhibit CLOCK NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CRY2