CRMP5 Antibody

Images

 
Immunohistochemistry-Paraffin: CRMP5 Antibody [NBP1-85461] - Staining of human lateral ventricle shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CRMP5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GRVVYENGVFMCAEGTGKFCPLRSFPDTVYKKLVQREKTLKVRGVDRTPYL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DPYSL5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CRMP5 Protein (NBP1-85461PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CRMP5 Antibody

  • Collapsin response mediator protein 5
  • collapsin response mediator protein-5
  • CRAMCRMP3-associated molecule
  • CRMP-5FLJ45383
  • CRMP5UNC33-like phosphoprotein 6
  • dihydropyrimidinase-like 5
  • dihydropyrimidinase-related protein 5
  • DRP-5
  • Ulip6
  • ULIP-6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85447
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85448
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2299
Species: Mu
Applications: WB, IHC
NBP2-13937
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32505
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-76652
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
NBP1-85224
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5519
Species: Mu
Applications: Flow, CyTOF-ready, ICC
NBP1-87679
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
H00001996-M01
Species: Hu, Rt
Applications: WB, ELISA, IHC-P, RNAi
H00005957-M37
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-85461
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for CRMP5 Antibody (NBP1-85461) (0)

There are no publications for CRMP5 Antibody (NBP1-85461).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRMP5 Antibody (NBP1-85461) (0)

There are no reviews for CRMP5 Antibody (NBP1-85461). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CRMP5 Antibody (NBP1-85461) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CRMP5 Products

Bioinformatics Tool for CRMP5 Antibody (NBP1-85461)

Discover related pathways, diseases and genes to CRMP5 Antibody (NBP1-85461). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRMP5 Antibody (NBP1-85461)

Discover more about diseases related to CRMP5 Antibody (NBP1-85461).
 

Pathways for CRMP5 Antibody (NBP1-85461)

View related products by pathway.

PTMs for CRMP5 Antibody (NBP1-85461)

Learn more about PTMs related to CRMP5 Antibody (NBP1-85461).
 

Research Areas for CRMP5 Antibody (NBP1-85461)

Find related products by research area.

Blogs on CRMP5

There are no specific blogs for CRMP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRMP5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DPYSL5