CRMP5 Antibody - BSA Free

Immunohistochemistry-Paraffin: CRMP5 Antibody [NBP1-85461] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: CRMP5 Antibody [NBP1-85461] - Staining of human lateral ventricle shows moderate cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: CRMP5 Antibody [NBP1-85461] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: CRMP5 Antibody [NBP1-85461] - Staining in human cerebral cortex and pancreas tissues using anti-DPYSL5 antibody. Corresponding DPYSL5 RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CRMP5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CRMP5 Antibody - BSA Free (NBP1-85461) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GRVVYENGVFMCAEGTGKFCPLRSFPDTVYKKLVQREKTLKVRGVDRTPYL
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DPYSL5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CRMP5 Protein (NBP1-85461PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CRMP5 Antibody - BSA Free

• Collapsin response mediator protein 5
• collapsin response mediator protein-5
• CRAMCRMP3-associated molecule
• CRMP-5FLJ45383
• CRMP5UNC33-like phosphoprotein 6
• dihydropyrimidinase-like 5
• dihydropyrimidinase-related protein 5
• DRP-5
• ULIP6
• ULIP-6

Background

The collapsin response mediator protein (CRMP) family of proteins (also referred to as ULIP6) are a group of neurologic proteins that have been found to play key roles in growth cone guidance during neural development. CRMP5 has relatively low sequence homology with the other four members of the CRMP family. CRMP5 is expressed in the developing nervous system in an expression pattern that resembles CRMP2 and has a peak expression during the first postnatal week. Elevated levels of autoantibody to CRMP5 have been shown to be linked paraneoplastic autoimmune optic neuritis and other paraneoplastic neoplasms. Auto-immunity against CRMP5 expression (predominantly the N-terminal epitopes) is also being investigated as an oncological marker in the respiratory system and in the thymus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DPYSL5