CRIM1 Antibody - BSA Free

Immunohistochemistry-Paraffin: CRIM1 Antibody [NBP1-80799] - Analysis in human placenta and liver tissues using NBP1-80799 antibody. Corresponding CRIM1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CRIM1 Antibody [NBP1-80799] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: CRIM1 Antibody [NBP1-80799] -Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: CRIM1 Antibody [NBP1-80799] Staining of human kidney shows moderate cytoplasmic and membranous positivity in cells in tubules.

Immunohistochemistry-Paraffin: CRIM1 Antibody [NBP1-80799] -Staining of human small intestine shows weak cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CRIM1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CRIM1 Antibody - BSA Free (NBP1-80799) is a polyclonal antibody validated for use in IHC. Anti-CRIM1 Antibody: Cited in 5 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTIRTCSNPFEFPSQDMCLSALKRIEEEKPDCSKARCEVQFSPRCPEDSVLIEGYAPPGECCPLP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CRIM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: IHC-P HIER pH6 retrieval is recommended.
• Control Peptide:

  CRIM1 Protein (NBP1-80799PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%). Mouse reactivity reported in scientific literature (PMID: 26545120)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CRIM1 Antibody - BSA Free

• CRIM1
• CRIM-1
• cysteine rich transmembrane BMP regulator 1 (chordin-like)
• cysteine-rich motor neuron 1 protein
• cysteine-rich motor neuron 1
• Cysteine-rich repeat-containing protein S52
• MGC138194
• S52

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CRIM1 Antibody (NBP1-80799)(5)

Publications using NBP1-80799

• Zhu X, Schrader JM, Irizarry BA et al. Impact of A beta 40 and A beta 42 Fibrils on the Transcriptome of Primary Astrocytes and Microglia Biomedicines 2022-11-19 [PMID: 36428550] (IHC-Fr, Rat)
  
  Details:
  Fifteen-month-old rTgF344-AD rat brain sections, dilution used 1:200
• Hudson BD, Hum NR, Thomas CB et al. SOST Inhibits Prostate Cancer Invasion. PLoS One 2015-01-01 [PMID: 26545120] (IF/IHC, Mouse)
• Chiu HS, York JP, Wilkinson L et al. Production of a Mouse Line with a Conditional Crim1 Mutant Allele. Genesis 2012-09-01 [PMID: 22511315]
• Nystrom J et al. CRIM1 is localized to the podocyte filtration slit diaphragm of the adult human kidney. Nephrol Dial Transplant;24(7):2038-44. 2009-07-01 [PMID: 19158190]
• Ek S, Andreasson U, Hober S et al. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Mol Cell Proteomics 2006-06-01 [PMID: 16524965]

Bioinformatics

• Gene Symbol: CRIM1
• Entrez:
  • 51232(Human)
• Uniprot:
  • Q9NZV1()