CRIM1 Antibody

Images

 
Immunohistochemistry-Paraffin: CRIM1 Antibody [NBP1-80799] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CRIM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTIRTCSNPFEFPSQDMCLSALKRIEEEKPDCSKARCEVQFSPRCPEDSVLIEGYAPPGECCPLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRIM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For Immunohistochemistry-Paraffin, HIER pH6 retrieval is recommended.
Control Peptide
CRIM1 Protein (NBP1-80799PEP)
Publications
Read Publications using
NBP1-80799 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%). Reactivity reported in scientific literature (PMID: 22511315)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CRIM1 Antibody

  • CRIM1
  • CRIM-1
  • cysteine rich transmembrane BMP regulator 1 (chordin-like)
  • cysteine-rich motor neuron 1 protein
  • cysteine-rich motor neuron 1
  • Cysteine-rich repeat-containing protein S52
  • MGC138194
  • S52

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DDX0390P-100
Species: Mu
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vivo
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
NBP1-60103
Species: Hu
Applications: WB, IHC
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-83242
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF921
Species: Hu
Applications: WB, IHC
NBP1-88872
Species: Hu
Applications: IHC, IHC-P
H00006444-M01-100ug
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-33738
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80799
Species: Hu
Applications: IHC, IHC-P

Publications for CRIM1 Antibody (NBP1-80799)(4)

Reviews for CRIM1 Antibody (NBP1-80799) (0)

There are no reviews for CRIM1 Antibody (NBP1-80799). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CRIM1 Antibody (NBP1-80799) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CRIM1 Products

Bioinformatics Tool for CRIM1 Antibody (NBP1-80799)

Discover related pathways, diseases and genes to CRIM1 Antibody (NBP1-80799). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRIM1 Antibody (NBP1-80799)

Discover more about diseases related to CRIM1 Antibody (NBP1-80799).
 

Pathways for CRIM1 Antibody (NBP1-80799)

View related products by pathway.

PTMs for CRIM1 Antibody (NBP1-80799)

Learn more about PTMs related to CRIM1 Antibody (NBP1-80799).

Blogs on CRIM1

There are no specific blogs for CRIM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRIM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRIM1
Entrez
Uniprot