CRELD1 Antibody


Western Blot: CRELD1 Antibody [NBP1-88917] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed more
Immunocytochemistry/ Immunofluorescence: CRELD1 Antibody [NBP1-88917] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli & cytosol.
Immunohistochemistry-Paraffin: CRELD1 Antibody [NBP1-88917] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunocytochemistry/ Immunofluorescence: CRELD1 Antibody [NBP1-88917] - Staining of human cell line U-2 OS shows positivity in cytoplasm.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

CRELD1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GAFPILTDLTPETTRRWKLGSHPHSTYVKMKMQRDEATFPGLYGKQVAKLGSQSRQSDRGTRL
Specificity of human CRELD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CRELD1 Protein (NBP1-88917PEP)
Read Publication using NBP1-88917.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CRELD1 Antibody

  • atrioventricular septal defect 2
  • AVSD2
  • CRELD1
  • cysteine-rich with EGF-like domain protein 1
  • cysteine-rich with EGF-like domains 1
  • DKFZp566D213


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC
Species: Mu
Applications: WB, Flow, ICC
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, IHC, Block
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Po, Bt, Bv, Ca, Eq, Mk, Pm, Rb
Applications: IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CRELD1 Antibody (NBP1-88917)(1)

Reviews for CRELD1 Antibody (NBP1-88917) (0)

There are no reviews for CRELD1 Antibody (NBP1-88917). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CRELD1 Antibody (NBP1-88917) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CRELD1 Products

Bioinformatics Tool for CRELD1 Antibody (NBP1-88917)

Discover related pathways, diseases and genes to CRELD1 Antibody (NBP1-88917). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRELD1 Antibody (NBP1-88917)

Discover more about diseases related to CRELD1 Antibody (NBP1-88917).

Pathways for CRELD1 Antibody (NBP1-88917)

View related products by pathway.

PTMs for CRELD1 Antibody (NBP1-88917)

Learn more about PTMs related to CRELD1 Antibody (NBP1-88917).

Blogs on CRELD1

There are no specific blogs for CRELD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CRELD1 Antibody and receive a gift card or discount.


Gene Symbol CRELD1