CRELD1 Antibody

Images

 
Western Blot: CRELD1 Antibody [NBP1-88917] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: CRELD1 Antibody [NBP1-88917] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli & cytosol.
Immunohistochemistry-Paraffin: CRELD1 Antibody [NBP1-88917] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunocytochemistry/ Immunofluorescence: CRELD1 Antibody [NBP1-88917] - Staining of human cell line U-2 OS shows positivity in cytoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CRELD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GAFPILTDLTPETTRRWKLGSHPHSTYVKMKMQRDEATFPGLYGKQVAKLGSQSRQSDRGTRL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRELD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CRELD1 Protein (NBP1-88917PEP)
Publications
Read Publication using NBP1-88917.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CRELD1 Antibody

  • atrioventricular septal defect 2
  • AVSD2
  • CIRRIN
  • CRELD1
  • cysteine-rich with EGF-like domain protein 1
  • cysteine-rich with EGF-like domains 1
  • DKFZp566D213

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
AF3686
Species: Mu
Applications: WB
AF5310
Species: Hu, Mu
Applications: WB, ICC
MAB18401
Species: Mu
Applications: WB, Flow, ICC
NBP2-57809
Species: Hu
Applications: ICC/IF
AF339
Species: Hu
Applications: WB, IHC, Block
NBP1-88831
Species: Hu
Applications: WB, IHC, IHC-P
AF4248
Species: Hu
Applications: WB, ICC
AF7899
Species: Hu
Applications: WB, IHC
NBP1-33479
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF4539
Species: Hu, Mu, Rt
Applications: WB
NBP2-57763
Species: Hu
Applications: ICC/IF
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NLS12
Species: Hu, Po, Bt, Bv, Ca, Eq, Mk, Pm, Rb
Applications: IHC-P
NB100-78585
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CRELD1 Antibody (NBP1-88917)(1)

Reviews for CRELD1 Antibody (NBP1-88917) (0)

There are no reviews for CRELD1 Antibody (NBP1-88917). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CRELD1 Antibody (NBP1-88917) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CRELD1 Products

Bioinformatics Tool for CRELD1 Antibody (NBP1-88917)

Discover related pathways, diseases and genes to CRELD1 Antibody (NBP1-88917). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRELD1 Antibody (NBP1-88917)

Discover more about diseases related to CRELD1 Antibody (NBP1-88917).
 

Pathways for CRELD1 Antibody (NBP1-88917)

View related products by pathway.

PTMs for CRELD1 Antibody (NBP1-88917)

Learn more about PTMs related to CRELD1 Antibody (NBP1-88917).

Blogs on CRELD1

There are no specific blogs for CRELD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRELD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRELD1
Entrez