CREBL2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CREBL2 Antibody [NBP1-86200] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: CREBL2 Antibody [NBP1-86200] - Staining of human adrenal gland shows strong cytoplsmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CREBL2 Antibody [NBP1-86200] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts and Leydig cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CREBL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:REELEMYKQWCMAMDQGKIPSEIKALLTGEEQNKSQQNSSRHTKAGKTDANSNSW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CREBL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CREBL2 Protein (NBP1-86200PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CREBL2 Antibody

  • cAMP responsive element binding protein-like 2
  • cAMP-responsive element-binding protein-like 2
  • MGC117311
  • MGC138362

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-410
Species: Hu, Mu
Applications: WB, IP
AF1555
Species: Hu
Applications: WB
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2593
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
H00000466-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P
H00003400-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-84988
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91697
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
AF1505
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP1-86200
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for CREBL2 Antibody (NBP1-86200) (0)

There are no publications for CREBL2 Antibody (NBP1-86200).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CREBL2 Antibody (NBP1-86200) (0)

There are no reviews for CREBL2 Antibody (NBP1-86200). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CREBL2 Antibody (NBP1-86200) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CREBL2 Products

Bioinformatics Tool for CREBL2 Antibody (NBP1-86200)

Discover related pathways, diseases and genes to CREBL2 Antibody (NBP1-86200). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CREBL2 Antibody (NBP1-86200)

Discover more about diseases related to CREBL2 Antibody (NBP1-86200).
 

Pathways for CREBL2 Antibody (NBP1-86200)

View related products by pathway.

PTMs for CREBL2 Antibody (NBP1-86200)

Learn more about PTMs related to CREBL2 Antibody (NBP1-86200).
 

Research Areas for CREBL2 Antibody (NBP1-86200)

Find related products by research area.

Blogs on CREBL2

There are no specific blogs for CREBL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CREBL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CREBL2