CREBL2 Antibody


Immunocytochemistry/ Immunofluorescence: CREBL2 Antibody [NBP1-86200] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: CREBL2 Antibody [NBP1-86200] - Staining of human adrenal gland shows strong cytoplsmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CREBL2 Antibody [NBP1-86200] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts and Leydig cells.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

CREBL2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: REELEMYKQWCMAMDQGKIPSEIKALLTGEEQNKSQQNSSRHTKAGKTDANSNSW
Specificity of human CREBL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CREBL2 Protein (NBP1-86200PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CREBL2 Antibody

  • cAMP responsive element binding protein-like 2
  • cAMP-responsive element-binding protein-like 2
  • MGC117311
  • MGC138362


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for CREBL2 Antibody (NBP1-86200) (0)

There are no publications for CREBL2 Antibody (NBP1-86200).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CREBL2 Antibody (NBP1-86200) (0)

There are no reviews for CREBL2 Antibody (NBP1-86200). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CREBL2 Antibody (NBP1-86200) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CREBL2 Products

Bioinformatics Tool for CREBL2 Antibody (NBP1-86200)

Discover related pathways, diseases and genes to CREBL2 Antibody (NBP1-86200). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CREBL2 Antibody (NBP1-86200)

Discover more about diseases related to CREBL2 Antibody (NBP1-86200).

Pathways for CREBL2 Antibody (NBP1-86200)

View related products by pathway.

PTMs for CREBL2 Antibody (NBP1-86200)

Learn more about PTMs related to CREBL2 Antibody (NBP1-86200).

Research Areas for CREBL2 Antibody (NBP1-86200)

Find related products by research area.

Blogs on CREBL2

There are no specific blogs for CREBL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CREBL2 Antibody and receive a gift card or discount.


Gene Symbol CREBL2