CREB3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CREB3 Antibody [NBP2-58307] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CREB3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTS
• Predicted Species: Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CREB3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CREB3 Recombinant Protein Antigen (NBP2-58307PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CREB3 Antibody - BSA Free

• basic leucine zipper protein
• cAMP responsive element binding protein 3 (luman)
• cAMP responsive element binding protein 3
• cAMP-responsive element-binding protein 3
• CREB-3
• cyclic AMP response element (CRE)-binding protein/activating transcriptionfactor 1
• cyclic AMP-responsive element-binding protein 3
• LUMAN
• LZIPMGC15333
• MGC19782
• Transcription factor LZIP-alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CREB3