CREB3 Antibody

Images

 
Western Blot: CREB3 Antibody [H00010488-D01P] - Analysis of CREB3 recombinant protein by CREB3 purified antibody.
Western Blot: CREB3 Antibody [H00010488-D01P] - Analysis of CREB3 expression in transfected 293T cell line by CREB3 polyclonal antibody.Lane 1: CREB3 transfected lysate(41.40 KDa).Lane 2: Non-transfected lysate.
Proximity Ligation Assay: CREB3 Antibody [H00010488-D01P] - Analysis of protein-protein interactions between CREB3 and CREB3L4. HeLa cells were stained with anti-CREB3 rabbit purified polyclonal 1:1200 and anti-CREB3L4 ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IP, PLA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CREB3 Antibody Summary

Immunogen
CREB3 (AAH09402.1, 1 a.a. - 371 a.a.) full-length human protein. MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAIYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG
Specificity
CREB3 - cAMP responsive element binding protein 3,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CREB3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • Immunoprecipitation
  • Proximity Ligation Assay
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Publications
Read Publication using H00010488-D01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CREB3 Antibody

  • basic leucine zipper protein
  • cAMP responsive element binding protein 3 (luman)
  • cAMP responsive element binding protein 3
  • cAMP-responsive element-binding protein 3
  • CREB-3
  • cyclic AMP response element (CRE)-binding protein/activating transcriptionfactor 1
  • cyclic AMP-responsive element-binding protein 3
  • LUMAN
  • LZIPMGC15333
  • MGC19782
  • Transcription factor LZIP-alpha

Background

This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-responsive element, an octameric palindrome. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. An additional transcript variant has been identified, but its biological validity has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-68209
Species: Hu
Applications: WB, IP, KD
NBP1-40256
Species: Hu, Mu, Rt, Po, Pl, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC, KO
H00148327-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, PLA, KD
NBP2-57754
Species: Hu
Applications: ICC/IF
NBP1-90364
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13873
Species: Hu
Applications: WB, IHC, IHC-P
MAB363
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-45970
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB600-799
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB145
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-88697
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-P, ChIP
NBP1-79997
Species: Hu
Applications: WB
NBP2-26061
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, PEP-ELISA
NBP2-37576
Species: Hu, Mu, Pm, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-93935
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00010488-D01P
Species: Hu
Applications: WB, IP, PLA

Publications for CREB3 Antibody (H00010488-D01P)(1)

Reviews for CREB3 Antibody (H00010488-D01P) (0)

There are no reviews for CREB3 Antibody (H00010488-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CREB3 Antibody (H00010488-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CREB3 Products

Bioinformatics Tool for CREB3 Antibody (H00010488-D01P)

Discover related pathways, diseases and genes to CREB3 Antibody (H00010488-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CREB3 Antibody (H00010488-D01P)

Discover more about diseases related to CREB3 Antibody (H00010488-D01P).
 

Pathways for CREB3 Antibody (H00010488-D01P)

View related products by pathway.

PTMs for CREB3 Antibody (H00010488-D01P)

Learn more about PTMs related to CREB3 Antibody (H00010488-D01P).

Blogs on CREB3

There are no specific blogs for CREB3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CREB3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CREB3
Entrez
Uniprot