CREB3 Antibody - Azide and BSA Free

Western Blot: CREB3 Antibody [H00010488-D01P] - Analysis of CREB3 recombinant protein by CREB3 purified antibody.

Western Blot: CREB3 Antibody [H00010488-D01P] - Analysis of CREB3 expression in transfected 293T cell line by CREB3 polyclonal antibody.Lane 1: CREB3 transfected lysate(41.40 KDa).Lane 2: Non-transfected lysate.

Proximity Ligation Assay: CREB3 Antibody [H00010488-D01P] - Analysis of protein-protein interactions between CREB3 and CREB3L4. HeLa cells were stained with anti-CREB3 rabbit purified polyclonal 1:1200 and anti-CREB3L4 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

• Reactivity: Hu
• Applications: WB, Func, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CREB3 Antibody - Azide and BSA Free Summary

• Immunogen: CREB3 (AAH09402.1, 1 a.a. - 371 a.a.) full-length human protein. MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAIYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG
• Specificity: CREB3 - cAMP responsive element binding protein 3,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CREB3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunoprecipitation
  • Proximity Ligation Assay
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CREB3 Antibody - Azide and BSA Free

• basic leucine zipper protein
• cAMP responsive element binding protein 3 (luman)
• cAMP responsive element binding protein 3
• cAMP-responsive element-binding protein 3
• CREB-3
• cyclic AMP response element (CRE)-binding protein/activating transcriptionfactor 1
• cyclic AMP-responsive element-binding protein 3
• LUMAN
• LZIPMGC15333
• MGC19782
• Transcription factor LZIP-alpha

Background

This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-responsive element, an octameric palindrome. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. An additional transcript variant has been identified, but its biological validity has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CREB3 Antibody (H00010488-D01P)(1)

Publication using H00010488-D01P

• Hacker B, Schultheis C, Doring M et al. Molecular partners of hNOT/ALG3, the human counterpart of the Drosophila NOT and yeast ALG3 gene, suggest its involvement in distinct cellular processes relevant to congenital disorders of glycosylation, cancer, neurodegeneration and a variety of further Hum Mol Genet 2018-03-14 [PMID: 29547901]

Bioinformatics

• Gene Symbol: CREB3
• Entrez:
  • 10488(Human)
• Uniprot:
  • AAH09402.1(Human)