CRBN Antibody Blocking Peptide Summary
| Description |
A human WNT3A antibody blocking peptide. Source: Synthetic Amino Acid Sequence: (Accession #: Q96SW2) GNHLPLLPAESEEEDEMEVEDQDSKEAKKPNIINFDTSLPTSHTYLGADM |
| Source |
Synthetic |
| Protein/Peptide Type |
Antibody Blocking Peptide |
| Gene |
CRBN |
| Purity |
N/A |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This peptide is useful as a blocking peptide for NBP1-56305. This synthetic peptide is designed for use in an antibody competition assay with its corresponding antibody. Use of this product in any other assay has not yet been tested.For further blocking peptide related protocol, click here. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
Lyophilized with sterile distilled water. |
| Preservative |
No Preservative |
| Concentration |
LYOPH |
| Purity |
N/A |
| Reconstitution Instructions |
Reconstitute with 100ul of sterile PBS for a final peptide concentration of 1 mg/ml. |
Notes
For longer periods of storage, aliquot and store at -20C. Avoid repeat freeze-thaw cycles.
Alternate Names for CRBN Antibody Blocking Peptide
Background
Modulates cell surface expression of KCNT1 . May be involved in memory and learning
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Pm, Rt, Xp, Ze
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt, Sq, Xp
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu
Applications: AC
Publications for CRBN Protein (NBP1-56305PEP) (0)
There are no publications for CRBN Protein (NBP1-56305PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CRBN Protein (NBP1-56305PEP) (0)
There are no reviews for CRBN Protein (NBP1-56305PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for CRBN Protein (NBP1-56305PEP) (0)
Additional CRBN Products
Research Areas for CRBN Protein (NBP1-56305PEP)
Find related products by research area.
|
Blogs on CRBN