CPSF73 Antibody


Western Blot: CPSF73 Antibody [NBP1-85476] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: CPSF73 Antibody [NBP1-85476] - Staining of human gall bladder shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

CPSF73 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PFNLLCYQLQKLTGDVEELEIQEKPALKVFKNITVIQEPGMVVLEWLANPSNDMYADTVTTVILEVQSNPKIRKGAVQK
Specificity of human, mouse, rat CPSF73 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CPSF73 Protein (NBP1-85476PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CPSF73 Antibody

  • cleavage and polyadenylation specific factor 3, 73kD subunit
  • cleavage and polyadenylation specific factor 3, 73kDa
  • cleavage and polyadenylation specificity factor 3
  • Cleavage and polyadenylation specificity factor 73 kDa subunit
  • cleavage and polyadenylation specificity factor subunit 3
  • CPSF 73 kDa subunit
  • CPSF-73
  • EC 3.1.27
  • EC 3.1.27.-
  • mRNA 3'-end-processing endonuclease CPSF-73
  • YSH1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu, Mu
Applications: WB, IHC-P
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, KO
Species: Mu
Applications: WB
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for CPSF73 Antibody (NBP1-85476) (0)

There are no publications for CPSF73 Antibody (NBP1-85476).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPSF73 Antibody (NBP1-85476) (0)

There are no reviews for CPSF73 Antibody (NBP1-85476). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CPSF73 Antibody (NBP1-85476) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CPSF73 Products

Bioinformatics Tool for CPSF73 Antibody (NBP1-85476)

Discover related pathways, diseases and genes to CPSF73 Antibody (NBP1-85476). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPSF73 Antibody (NBP1-85476)

Discover more about diseases related to CPSF73 Antibody (NBP1-85476).

Pathways for CPSF73 Antibody (NBP1-85476)

View related products by pathway.

PTMs for CPSF73 Antibody (NBP1-85476)

Learn more about PTMs related to CPSF73 Antibody (NBP1-85476).

Blogs on CPSF73

There are no specific blogs for CPSF73, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CPSF73 Antibody and receive a gift card or discount.


Gene Symbol CPSF3