CPNE3 Antibody (4F4) - Azide and BSA Free

Western Blot: CPNE3 Antibody (4F4) [H00008895-M02-100ug] - Detection against Immunogen (34.65 KDa) .

Western Blot: CPNE3 Antibody (4F4) [H00008895-M02-100ug] - Analysis of CPNE3 expression in MCF-7.

ELISA: CPNE3 Antibody (4F4) [H00008895-M02-100ug] - Detection limit for recombinant GST tagged CPNE3 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4F4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CPNE3 Antibody (4F4) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse CPNE3 Antibody (4F4) - Azide and BSA Free (H00008895-M02-100ug) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: CPNE3 (NP_003900.1, 164 a.a. ~ 244 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EFHKQTSDGNWLMVHRTEVVKNNLNPVWRPFKISLNSLCYGDMDKTIKVECYDYDNDGSHDLIGTFQTTMTKLKEASRSSP
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CPNE3
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A or G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CPNE3 Antibody (4F4) - Azide and BSA Free

• copine IIICPN3KIAA0636
• copine-3
• PRO1071

Background

Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a protein which contains two type II C2 domains in the amino-terminus and an A domain-like sequence in the carboxy-terminus. The A domain mediates interactions between integrins and extracellular ligands. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CPNE3
• Entrez:
  • 8895(Human)
• OMIM:
  • 604207(Human)
• Uniprot:
  • NP_003900.1(Human)