CPNE1 Antibody

Images

 
Western Blot: CPNE1 Antibody [NBP2-54980] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: CPNE1 Antibody [NBP2-54980] - Staining of human cell line CACO-2 shows localization to nucleoplasm & nuclear membrane.
Western Blot: CPNE1 Antibody [NBP2-54980] - Analysis in human cell lines Caco-2 and U2OS. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CPNE1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KNNLNPTWKRFSVPVQHFCGGNPSTPIQVQCSDYDSDGS
Specificity
Specificity of human CPNE1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CPNE1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
CPNE1 Lysate (NBP2-65479)
Control Peptide
CPNE1 Recombinant Protein Antigen (NBP2-54980PEP)

Reactivity Notes

Mouse 87%, Rat 85%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CPNE1 Antibody

  • copine ICPN1COPN1
  • copine-1
  • MGC1142

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30692
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13891
Species: Hu
Applications: IHC, IHC-P
NBP2-13208
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB1936
Species: Hu
Applications: WB, IP
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NB110-60521
Species: Hu
Applications: WB, Flow
NBP1-87521
Species: Hu
Applications: WB, IHC, IHC-P
H00006045-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-89993
Species: Hu
Applications: WB, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-02082
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85827
Species: Hu
Applications: IHC, IHC-P
H00005555-P01
Species: Hu
NBP1-85939
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB3648
Species: Hu
Applications: Flow, CyTOF-ready, Neut
NBP2-54980
Species: Hu
Applications: WB, ICC/IF

Publications for CPNE1 Antibody (NBP2-54980) (0)

There are no publications for CPNE1 Antibody (NBP2-54980).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPNE1 Antibody (NBP2-54980) (0)

There are no reviews for CPNE1 Antibody (NBP2-54980). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CPNE1 Antibody (NBP2-54980) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CPNE1 Antibody (NBP2-54980)

Discover related pathways, diseases and genes to CPNE1 Antibody (NBP2-54980). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPNE1 Antibody (NBP2-54980)

Discover more about diseases related to CPNE1 Antibody (NBP2-54980).
 

Pathways for CPNE1 Antibody (NBP2-54980)

View related products by pathway.

Blogs on CPNE1

There are no specific blogs for CPNE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPNE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CPNE1