Recombinant Human COX7A2L GST (N-Term) Protein

SDS-Page: Recombinant Human COX7A2L Protein [H00009167-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, PAGE, AP

Recombinant Human COX7A2L GST (N-Term) Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-114 of Human COX7A2L
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: COX7A2L
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 38.17 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human COX7A2L GST (N-Term) Protein

• COX7ARcytochrome c oxidase subunit VII-related protein
• COX7a-related protein
• COX7RPmitochondrial
• cytochrome c oxidase subunit VIIa polypeptide 2 like
• Cytochrome c oxidase subunit VIIa-related protein
• estrogen receptor binding CpG island
• SIG81

Background

Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein similar to polypeptides 1 and 2 of subunit VIIa in the C-terminal region, and also highly similar to the mouse Sig81 protein sequence. This gene is expressed in all tissues, and upregulated in a breast cancer cell line after estrogen treatment. It is possible that this gene represents a regulatory subunit of COX and mediates the higher level of energy production in target cells by estrogen. COX7A2L( AAH05251, 1 a.a. - 115 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: COX7A2L