Recombinant Human COX7A2L GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human COX7A2L GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 2-88 of Human COX7A2L

Source: Wheat Germ (in vitro)

Amino Acid Sequence: YYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYR

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
COX7A2L
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
35.31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human COX7A2L GST (N-Term) Protein

  • COX7ARcytochrome c oxidase subunit VII-related protein
  • COX7a-related protein
  • COX7RPmitochondrial
  • cytochrome c oxidase subunit VIIa polypeptide 2 like
  • Cytochrome c oxidase subunit VIIa-related protein
  • estrogen receptor binding CpG island
  • SIG81

Background

Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein similar to polypeptides 1 and 2 of subunit VIIa in the C-terminal region, and also highly similar to the mouse Sig81 protein sequence. This gene is expressed in all tissues, and upregulated in a breast cancer cell line after estrogen treatment. It is possible that this gene represents a regulatory subunit of COX and mediates the higher level of energy production in target cells by estrogen. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-84928
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85568
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00027349-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP1-86509
Species: Hu
Applications: IHC, IHC-P
NBP2-00714
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-56441
Species: Hu, Mu, Rt
Applications: WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
AF5414
Species: Hu
Applications: Simple Western, WB
AF2335
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
H00008518-M03
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB500-207
Species: Hu
Applications: ICC/IF, IP, WB
NB100-68205
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-30463
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IP, WB
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP1-85569
Species: Hu
Applications: IHC, IHC-P, WB
H00011004-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, S-ELISA, WB
H00008826-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
H00009167-Q01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for COX7A2L Partial Recombinant Protein (H00009167-Q01) (0)

There are no publications for COX7A2L Partial Recombinant Protein (H00009167-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COX7A2L Partial Recombinant Protein (H00009167-Q01) (0)

There are no reviews for COX7A2L Partial Recombinant Protein (H00009167-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COX7A2L Partial Recombinant Protein (H00009167-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COX7A2L Products

Bioinformatics Tool for COX7A2L Partial Recombinant Protein (H00009167-Q01)

Discover related pathways, diseases and genes to COX7A2L Partial Recombinant Protein (H00009167-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COX7A2L Partial Recombinant Protein (H00009167-Q01)

Discover more about diseases related to COX7A2L Partial Recombinant Protein (H00009167-Q01).

Research Areas for COX7A2L Partial Recombinant Protein (H00009167-Q01)

Find related products by research area.

Blogs on COX7A2L

There are no specific blogs for COX7A2L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human COX7A2L GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol COX7A2L