COX-2 Antibody (2V7G8)

Western Blot: COX-2 Antibody (2V7G8) [NBP3-16220] - Analysis of extracts of various cell lines, using COX-2 antibody (NBP3-16220) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunohistochemistry-Paraffin: COX-2 Antibody (2V7G8) [NBP3-16220] -Human colon carcinoma tissue using COX2/PTGS2 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry-Paraffin: COX-2 Antibody (2V7G8) [NBP3-16220] -Human colon tissue using COX2/PTGS2 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry-Paraffin: COX-2 Antibody (2V7G8) [NBP3-16220] -Aanalysis of COX2/PTGS2 in paraffin-embedded mouse intestin tissue using COX2/PTGS2 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry-Paraffin: COX-2 Antibody (2V7G8) [NBP3-16220] - Analysis of COX2/PTGS2 in paraffin-embedded rat colon tissue using COX2/PTGS2 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clone: 2V7G8
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

COX-2 Antibody (2V7G8) Summary

• Description: Novus Biologicals Rabbit COX-2 Antibody (2V7G8) (NBP3-16220) is a recombinant monoclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 505-604 of human COX-2 (P35354). GETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKERSTEL
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PTGS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunohistochemistry 1:200 - 1:2000
  • Immunohistochemistry-Paraffin 1:200 - 1:2000
  • Western Blot 1:1000 - 1:6000
• Theoretical MW: 69 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for COX-2 Antibody (2V7G8)

• COX2
• COX-2
• COX2cyclooxygenase 2b
• cyclooxygenase-2
• EC 1.14.99
• EC 1.14.99.1
• GRIPGHS
• hCox-2
• PGG/HS
• PGH synthase 2
• PGHS-2
• PHS II
• PHS-2
• PHS-II
• prostaglandin G/H synthase 2
• prostaglandin G/H synthase and cyclooxygenase
• Prostaglandin H2 synthase 2
• prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase andcyclooxygenase)
• Prostaglandin-endoperoxide synthase 2
• PTGS2

Background

COX2 (Cyclooxygenase 2) is an inducible enzyme. It is involved in the response of cells to growth factors, tumor promoters, and cytokines that induce its expression. Given its role in synthesizing prostaglandins, COX2 is therefore of interest in studying immune response regulation. COX2 is induced by a wide variety of stimuli and was initially identified as immediate early growth response gene. In addition, COX2 expression markedly increased in 85-90% of human colorectal adenocarcinoma whereas COX1 levels remain unchanged.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PTGS2