COX-1 Antibody - Azide and BSA Free

Western Blot: COX-1 Antibody [NBP3-05599] - Western blot analysis of extracts of mouse skeletal muscle, using COX-1 antibody (NBP3-05599) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunohistochemistry: COX-1 Antibody - Azide and BSA Free [COX-1] - Immunohistochemistry analysis of paraffin-embedded Human liver using COX-1 Rabbit pAb at dilution of 1:20 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Western Blot: COX-1 Antibody - Azide and BSA Free [COX-1] - Western blot analysis of lysates from NIH/3T3 cells using COX-1 Rabbit pAb at 1:1800 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time:30s.

Western Blot: COX-1 Antibody - Azide and BSA Free [COX-1] - Western blot analysis of lysates from NIH/3T3 cells, using COX-1 Rabbit pAb at 1:400 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

COX-1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit COX-1 Antibody - Azide and BSA Free (NBP3-05599) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 415-514 of mouse COX-1 (NP_904330.1). AIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTTWNTVSSMGSFISLTAVLIMIFMIWEAFASKREVMSVSYASTNLEWLHGCPPPYHTFEEPTYVKVK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTGS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:100 - 1:500
• Theoretical MW: 56 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for COX-1 Antibody - Azide and BSA Free

• COX1
• COX-1
• COX1PGG/HS
• COX3
• cyclooxygenase-1
• EC 1.14.99.1
• PCOX1
• PGH synthase 1
• PGHS1
• PGHS-1PHS1
• PHS 1
• prostaglandin G/H synthase 1
• prostaglandin G/H synthase and cyclooxygenase
• Prostaglandin H2 synthase 1
• prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase andcyclooxygenase)
• Prostaglandin-endoperoxide synthase 1
• PTGHS
• PTGS1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for COX-1 Antibody (NBP3-05599). (Showing 1 - 1 of 1 FAQ).

1. Please could you tell me if Novus Biologicals has an active COX1 Recombinant Protein?
   • Unfortunately we do not currently have any COX1 recombinant proteins that are expected to be active.

Bioinformatics

• Gene Symbol: PTGS1