COUP-TF II/NR2F2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: COUP-TF II/NR2F2 Antibody [NBP2-68746] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COUP-TF II/NR2F2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAA
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NR2F2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
COUP-TF II/NR2F2 Recombinant Protein Antigen (NBP2-68746PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for COUP-TF II/NR2F2 Antibody

  • Apolipoprotein A-I regulatory protein 1
  • ARP-1
  • ARP1ADP-ribosylation factor related protein 1
  • chicken ovalbumin upstream promoter transcription factor 2
  • COUP transcription factor 2
  • COUP transcription factor II
  • COUPTF II
  • COUP-TF II
  • COUP-TF2
  • COUPTFB
  • COUPTFII
  • COUP-TFII
  • MGC117452
  • NR2F2
  • Nuclear receptor subfamily 2 group F member 2
  • nuclear receptor subfamily 2, group F, member 2
  • SVP40
  • TFCOUP2apolipoprotein AI regulatory protein 1

Background

Regulation of the apolipoprotein A-I gene transcription. Binds to DNA site A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-922
Species: Ch
Applications: ELISA, IHC, IP, Single-Cell Western, WB
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24510
Species: Ca, Hu, Pm
Applications: WB
AF4186
Species: Hu
Applications: ICC, WB
NBP1-89679
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-33596
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
NB200-322
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NBP1-89680
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-14306
Species: Hu
Applications: IHC, IHC-P, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
NB120-5802
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
H00057016-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-88838
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DPSG10
Species: Hu
Applications: ELISA
NBP2-68746
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for COUP-TF II/NR2F2 Antibody (NBP2-68746) (0)

There are no publications for COUP-TF II/NR2F2 Antibody (NBP2-68746).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COUP-TF II/NR2F2 Antibody (NBP2-68746) (0)

There are no reviews for COUP-TF II/NR2F2 Antibody (NBP2-68746). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for COUP-TF II/NR2F2 Antibody (NBP2-68746) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COUP-TF II/NR2F2 Products

Bioinformatics Tool for COUP-TF II/NR2F2 Antibody (NBP2-68746)

Discover related pathways, diseases and genes to COUP-TF II/NR2F2 Antibody (NBP2-68746). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COUP-TF II/NR2F2 Antibody (NBP2-68746)

Discover more about diseases related to COUP-TF II/NR2F2 Antibody (NBP2-68746).
 

Pathways for COUP-TF II/NR2F2 Antibody (NBP2-68746)

View related products by pathway.

PTMs for COUP-TF II/NR2F2 Antibody (NBP2-68746)

Learn more about PTMs related to COUP-TF II/NR2F2 Antibody (NBP2-68746).

Blogs on COUP-TF II/NR2F2

There are no specific blogs for COUP-TF II/NR2F2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COUP-TF II/NR2F2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NR2F2