COUP-TF II/NR2F2 Antibody

Images

 
Western Blot: COUP-TF II/NR2F2 Antibody [H00007026-B01P] - Analysis of NR2F2 expression in transfected 293T cell line by NR2F2 polyclonal antibody. Lane 1: NR2F2 transfected lysate(45.54 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

COUP-TF II/NR2F2 Antibody Summary

Immunogen
NR2F2 (NP_066285.1, 1 a.a. - 414 a.a.) full-length human protein. MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQGGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ
Specificity
NR2F2 - nuclear receptor subfamily 2, group F, member 2,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
NR2F2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for COUP-TF II/NR2F2 Antibody

  • Apolipoprotein A-I regulatory protein 1
  • ARP-1
  • ARP1ADP-ribosylation factor related protein 1
  • chicken ovalbumin upstream promoter transcription factor 2
  • COUP transcription factor 2
  • COUP transcription factor II
  • COUPTF II
  • COUP-TF II
  • COUP-TF2
  • COUPTFB
  • COUPTFII
  • COUP-TFII
  • MGC117452
  • NR2F2
  • Nuclear receptor subfamily 2 group F member 2
  • nuclear receptor subfamily 2, group F, member 2
  • SVP40
  • TFCOUP2apolipoprotein AI regulatory protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-24510
Species: Hu, Ca, Pm
Applications: WB
AF4186
Species: Hu
Applications: WB, ICC
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-14306
Species: Hu
Applications: WB, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB120-2781
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-Fr
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88838
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
H00007026-B01P
Species: Hu
Applications: WB

Publications for COUP-TF II/NR2F2 Antibody (H00007026-B01P) (0)

There are no publications for COUP-TF II/NR2F2 Antibody (H00007026-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COUP-TF II/NR2F2 Antibody (H00007026-B01P) (0)

There are no reviews for COUP-TF II/NR2F2 Antibody (H00007026-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COUP-TF II/NR2F2 Antibody (H00007026-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COUP-TF II/NR2F2 Products

Bioinformatics Tool for COUP-TF II/NR2F2 Antibody (H00007026-B01P)

Discover related pathways, diseases and genes to COUP-TF II/NR2F2 Antibody (H00007026-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COUP-TF II/NR2F2 Antibody (H00007026-B01P)

Discover more about diseases related to COUP-TF II/NR2F2 Antibody (H00007026-B01P).
 

Pathways for COUP-TF II/NR2F2 Antibody (H00007026-B01P)

View related products by pathway.

PTMs for COUP-TF II/NR2F2 Antibody (H00007026-B01P)

Learn more about PTMs related to COUP-TF II/NR2F2 Antibody (H00007026-B01P).
 

Research Areas for COUP-TF II/NR2F2 Antibody (H00007026-B01P)

Find related products by research area.

Blogs on COUP-TF II/NR2F2

There are no specific blogs for COUP-TF II/NR2F2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COUP-TF II/NR2F2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NR2F2
Entrez
Uniprot