Corticotropin Releasing Factor Recombinant Protein Antigen

Product Discontinued

Corticotropin Releasing Factor Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Corticotropin Releasing Factor.
  
  

  Source: E. coli

  Amino Acid Sequence: CRALLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQARPVLLRMGE

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CRH
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49356.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Corticotropin Releasing Factor Recombinant Protein Antigen

• corticoliberin
• corticotropin releasing hormone
• Corticotropin-releasing hormone
• CRFCorticotropin-releasing factor

Background

Corticotropin-releasing hormone (CRH) is a 41-amino acid peptide derived from a 191-amino acid preprohormone. CRH issecreted by the paraventricular nucleus (PVN) of the hypothalamus in response to stress. Marked reduction in CRH hasbeen observed in association with Alzheimer disease and autosomal recessive hypothalamic corticotropin dificiency hasmultiple and potentially fatal metabolic consequences including hypoglycemia and hepatitis. In addition to productionin the hypothalamus, CRH is also synthesized in peripheral tissues, such as T lymphocytes and is highly expressed inthe placenta. In the placenta CRH is a marker that determines the length of gestation and the timing of parturitionand delivery. A rapid increase in circulating levels of CRH occurs at the onset of parturition, suggesting that, inaddition to its metabolic functions, CRH may act as a trigger for parturition. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CRH