Coronin 3 Antibody - BSA Free

Immunohistochemistry-Paraffin: Coronin 3 Antibody [NBP1-85506] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

• Reactivity: Hu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Coronin 3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Coronin 3 Antibody - BSA Free (NBP1-85506) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKI
• Predicted Species: Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CORO1C
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Coronin 3 Protein (NBP1-85506PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Coronin 3 Antibody - BSA Free

• coronin 1C
• coronin, actin binding protein, 1C
• coronin, actin-binding protein, 1C
• coronin-1C
• Coronin-3
• CRNN4
• HCRNN4

Background

Coronin 3 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD). These may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. By similarity, Coronin 3 may be involved in cytokinesis, motility, and signal transduction. Coronin 3 is ubiquitously expressed in all human tissues, in contrast to other known coronin-like molecules, each of which is expressed in a tissue-specific manner.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CORO1C