Cornulin Antibody - BSA Free

Western Blot: Cornulin Antibody [NBP2-92568] - Western blot analysis of extracts of HepG2 cells, using Cornulin antibody (NBP2-92568) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cornulin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Cornulin Antibody - BSA Free (NBP2-92568) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 396-495 of human CRNN (NP_057274.1). GETVPGGQAQTGASTESGRQEWSSTHPRRCVTEGQGDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRGITARELYSYLRSTKP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CRNN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 53 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cornulin Antibody - BSA Free

• 53 kDa squamous epithelial-induced stress protein
• 58 kDa heat shock protein
• C1orf10
• chromosome 1 open reading frame 10
• Cornulin
• CRNN
• DRC1
• Gm1015
• PDRC1
• PDRC1,53 kDa putative calcium-binding protein
• SEP53
• SEP53C1orf10
• Squamous epithelial heat shock protein 53
• Tumor-related protein

Background

The CRNN gene encodes a member of the "fused gene" family of proteins, which contain N-terminus EF-hand domains and multiple tandem peptide repeats. The encoded protein contains two EF-hand Ca2+ binding domains in its N-terminus and two glutamine- and threoni

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CRNN