COQ7 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: COQ7 Antibody [NBP2-57950] - Staining of human cell line U-2 OS shows localization to plasma membrane.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

COQ7 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFR
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COQ7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  COQ7 Recombinant Protein Antigen (NBP2-57950PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for COQ7 Antibody - BSA Free

• CAT5
• CLK1
• CLK-1
• Coenzyme Q biosynthesis protein 7 homolog
• coenzyme Q, 7 (rat, yeast) homolog
• coenzyme Q7 homolog, ubiquinone (yeast)
• COQ7 coenzyme Q, 7 homolog ubiquinone
• placental protein KG-20
• Timing protein clk-1 homolog
• ubiquinone biosynthesis protein COQ7 homolog

Background

The protein encoded by the COQ7 gene is similar to a mitochondrial di-iron containing hydroxylase in Saccharomyces cerevisiae that is involved with ubiquinone biosynthesis. Mutations in the yeast gene lead to slower development and longer life span. Transcript variants have been described for this gene, but their full-length sequences have not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COQ7