CLK3 Antibody (1F10)

Images

 
Western Blot: CLK3 Antibody (1F10) [H00001198-M05] - Analysis of CLK3 expression in transfected 293T cell line by CLK3 monoclonal antibody (M05), clone 1F10. Lane 1: CLK3 transfected lysatE (58.6 KDa). Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: CLK3 Antibody (1F10) [H00001198-M05] - Analysis of monoclonal antibody to CLK3 on HeLa cell. Antibody concentration 8 ug/mL.
Immunohistochemistry-Paraffin: CLK3 Antibody (1F10) [H00001198-M05] - Analysis of monoclonal antibody to CLK3 on FFPE human placenta. Antibody concentration 0.5 ug/mL.
Western Blot: CLK3 Antibody (1F10) [H00001198-M05] - Analysis of CLK3 over-expressed 293 cell line, cotransfected with CLK3 Validated Chimera RNAi or non-transfected control. Blot probed with H00001198-M05. GAPDH (36.1 ...read more
Western Blot: CLK3 Antibody (1F10) [H00001198-M05] - Analysis of CLK3 expression in HeLa S3 NE (Cat # L013V3).
Western Blot: CLK3 Antibody (1F10) [H00001198-M05] - HeLa cell lysate. Antibody at 1:2000 in 5% BSA-TBST. Detection by Clarity Western ECL (BioRad). Image from verfied customer review.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, KD
Clone
1F10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CLK3 Antibody (1F10) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
CLK3 (AAH02555, 36 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSV
Specificity
CLK3 - CDC-like kinase 3
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CLK3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Knockdown Validated
  • Western Blot 1:500
Application Notes
Antibody reactivity against recombinant protein and cell lysate for WB. It has been used for IF, RNAi Validation, IHC-P and ELISA.
Reviewed Applications
Read 1 Review rated 4
using
H00001198-M05 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CLK3 Antibody (1F10)

  • CDC-like kinase 3
  • CDC-like kinase 3PHCLK3
  • CLK3
  • dual specificity protein kinase CLK3
  • EC 2.7.12.1
  • FLJ22858
  • PHCLK3/152

Background

This gene encodes a protein belonging to the serine/threonine type protein kinase family. This protein is a nuclear dual-specificity kinase that regulates the intranuclear distribution of the serine/arginine-rich (SR) family of splicing factors. Alternatively spliced transcript variants have been described for this gene, but their biological validity has not been determined. Pseudogenes located on chromosomes 1 and 9 have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CLK3 Antibody (H00001198-M05) (0)

There are no publications for CLK3 Antibody (H00001198-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for CLK3 Antibody (H00001198-M05) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00001198-M05:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot CLK3 H00001198-M05
Enlarge
4
reviewed by:
Verified Customer
WB Human 01/03/2019
View

Summary

ApplicationWestern Blot
Sample TestedHela Cell Lysate
SpeciesHuman
Lot09243-1F10 WEPc

Comments

CommentsDiluted CLK3 antibody (H00001198-M05) at 1:2000 in 5% BSA-TBST and probed the blot overnight at 4 degrees in shaker, followed by three 5 min washes in 1XTBST and probed with anti-Ms secondary at 1:5000, followed by three 5 min washes in 1XTBST and developed using Clarity Western ECL substrate from Bio-Rad. Shown is blot exposed for 7 s.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CLK3 Antibody (H00001198-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLK3 Products

Research Areas for CLK3 Antibody (H00001198-M05)

Find related products by research area.

Blogs on CLK3

There are no specific blogs for CLK3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Verified Customer
01/03/2019
Application: WB
Species: Human

Bioinformatics

Gene Symbol CLK3
Entrez
OMIM
Uniprot