COPS6 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: COPS6 Antibody [NBP1-91805] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: COPS6 Antibody [NBP1-91805] - Staining of human stomach, lower shows distinct nuclear positivity in glandular cells.

Staining of human colorectal cancer shows moderate nuclear positivity in tumor cells.

Staining of human liver shows no nuclear positivity in hepatocytes.

Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.

Staining of human cerebral cortex shows strong nuclear positivity in neurons.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

COPS6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit COPS6 Antibody - BSA Free (NBP1-91805) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-COPS6 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRM
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COPS6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  COPS6 Protein (NBP1-91805PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for COPS6 Antibody - BSA Free

• BMP2B
• BMP2B1
• BMP4
• COP9 constitutive photomorphogenic homolog subunit 6 (Arabidopsis)
• COP9 signalosome complex subunit 6
• CSN6COP9 subunit 6 (MOV34 homolog, 34 kD)
• H_NH0506M12.12
• HVIP
• JAB1-containing signalosome subunit 6
• MOFC11
• MOV34 homolog
• MOV34 homolog, 34 kD
• MOV34-34KD
• SGN6
• Signalosome subunit 6
• Vpr-interacting protein

Background

COPS6 is encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein belongs to translation initiation factor 3 (eIF3) superfamily. It is involved in the regulation of cell cycle and likely to be a cellular cofactor for HIV-1 accessory gene product Vpr. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for COPS6 Antibody (NBP1-91805)(1)

Publication using NBP1-91805

• Scimeca M, Piccirilli E, Mastrangeli F et al. Bone Morphogenetic Proteins and myostatin pathways: key mediator of human sarcopenia. J Transl Med 2017-02-15 [PMID: 28202082] (Human)

Bioinformatics

• Gene Symbol: COPS6