COPS6 Antibody - BSA Free

Western Blot: COPS6 Antibody [NBP1-79752] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Western Blot: COPS6 Antibody [NBP1-79752] - Sample Type: 1. ABAE cells 2. CHO-IR cells Primary Dilution: 1:200 Secondary antibody: HRP conjugated anti-rabbit Image Submitted By: Dr. Elah Pick University of Haifa at Oranim.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

COPS6 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the middle region of human COPS6The immunogen for this antibody is COPS6. Peptide sequence DHVARMTATGSGENSTVAEHLIAQHSAIKMLHSRVKLILEYVKASEAGEV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COPS6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 36 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for COPS6 Antibody - BSA Free

• BMP2B
• BMP2B1
• BMP4
• COP9 constitutive photomorphogenic homolog subunit 6 (Arabidopsis)
• COP9 signalosome complex subunit 6
• CSN6COP9 subunit 6 (MOV34 homolog, 34 kD)
• H_NH0506M12.12
• HVIP
• JAB1-containing signalosome subunit 6
• MOFC11
• MOV34 homolog
• MOV34 homolog, 34 kD
• MOV34-34KD
• SGN6
• Signalosome subunit 6
• Vpr-interacting protein

Background

COPS6 is encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein belongs to translation initiation factor 3 (eIF3) superfamily. It is involved in the regulation of cell cycle and likely to be a cellular cofactor for HIV-1 accessory gene product Vpr. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COPS6
• Uniprot:
  • NP_006824(Human)