COP9 signalosome complex subunit 2 Antibody

Images

 
Western Blot: COP9 signalosome complex subunit 2 Antibody [NBP1-90189] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: ...read more
Immunocytochemistry/ Immunofluorescence: COP9 signalosome complex subunit 2 Antibody [NBP1-90189] - Staining of human cell line A-431 shows positivity in nuclei but not nucleoli.
Immunohistochemistry-Paraffin: COP9 signalosome complex subunit 2 Antibody [NBP1-90189] - Staining of human stomach shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COP9 signalosome complex subunit 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COPS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COP9 signalosome complex subunit 2 Protein (NBP1-90189PEP)
Publications
Read Publication using NBP1-90189.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COP9 signalosome complex subunit 2 Antibody

  • Alien homolog
  • ALIEN
  • COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis)
  • COP9 signalosome complex subunit 2
  • CSN2JAB1-containing signalosome subunit 2
  • SGN2TR-interacting protein 15
  • Signalosome subunit 2
  • thyroid receptor interacting protein 15
  • Thyroid receptor-interacting protein 15
  • TRIP15TRIP-15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84407
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85436
Species: Hu
Applications: IHC, IHC-P
NBP1-85435
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001446-D01P
Species: Hu, Mu
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-85495
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-362
Species: Hu
Applications: WB, IHC-P, PLA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-90189
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for COP9 signalosome complex subunit 2 Antibody (NBP1-90189)(1)

Reviews for COP9 signalosome complex subunit 2 Antibody (NBP1-90189) (0)

There are no reviews for COP9 signalosome complex subunit 2 Antibody (NBP1-90189). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for COP9 signalosome complex subunit 2 Antibody (NBP1-90189) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COP9 signalosome complex subunit 2 Products

Bioinformatics Tool for COP9 signalosome complex subunit 2 Antibody (NBP1-90189)

Discover related pathways, diseases and genes to COP9 signalosome complex subunit 2 Antibody (NBP1-90189). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COP9 signalosome complex subunit 2 Antibody (NBP1-90189)

Discover more about diseases related to COP9 signalosome complex subunit 2 Antibody (NBP1-90189).
 

Pathways for COP9 signalosome complex subunit 2 Antibody (NBP1-90189)

View related products by pathway.

PTMs for COP9 signalosome complex subunit 2 Antibody (NBP1-90189)

Learn more about PTMs related to COP9 signalosome complex subunit 2 Antibody (NBP1-90189).
 

Research Areas for COP9 signalosome complex subunit 2 Antibody (NBP1-90189)

Find related products by research area.

Blogs on COP9 signalosome complex subunit 2

There are no specific blogs for COP9 signalosome complex subunit 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COP9 signalosome complex subunit 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COPS2