Recombinant Human Complement Component C5aR1 GST (N-Term) Protein

SDS-Page: Recombinant Human Complement Component C5a R1 Protein [H00000728-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, AP

Recombinant Human Complement Component C5aR1 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tagcorresponding to the amino acids 1-110 of Human C5R1 partial ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: LKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLNKLDSLCVSFAYINCCINPIIYVVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: C5AR1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Complement Component C5aR1 GST (N-Term) Protein

• C5a anaphylatoxin chemotactic receptor
• C5A
• C5aR
• C5a-R
• C5AR1
• C5ARC5a anaphylatoxin receptor
• C5R1C5a ligand
• CD88 antigen
• CD88
• complement component 5 receptor 1 (C5a ligand)
• complement component 5 receptor 1
• complement component 5a receptor 1
• Complement Component C5a R1
• Complement Component C5aR1

Background

C5R1 - complement component 5 receptor 1 (C5a ligand)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C5AR1