Recombinant Human COMMD3 Protein

Images

 
There are currently no images for COMMD3 Recombinant Protein (H00023412-P02).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human COMMD3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-195 of Human COMMD3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MELSESVQKGFQMLADPRSFDSNAFTLLLRAAFQSLLDAQADEAVLDHPDLKHIDPVVLKHCHAAAATYILEAGKHRADKSTLSTYLEDCKFDRERIELFCTEYQNNKNSLEILLGSIGRSLPHITDVSWRLEYQIKTNQLHRMYRPAYLVTLSVQNTDSPSYPEISFSCSMEQLQDLVGKLKDASKSLERATQL

Protein/Peptide Type
Recombinant Protein
Gene
COMMD3

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human COMMD3 Protein

  • BUPProtein Bup
  • C10orf8
  • chromosome 10 open reading frame 8
  • COMM domain containing 3
  • COMM domain-containing protein 3
  • DKFZp686K0399
  • FLJ45471
  • Protein PIL

Background

COMMD3 - COMM domain containing 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33748
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-90222
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-80923
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NBP2-01800
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85002
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90146
Species: Hu
Applications: IHC, IHC-P
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-98474
Species: Hu
Applications: WB
H00057804-M01A
Species: Hu
Applications: WB, ELISA
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-49672
Species: Hu
Applications: IHC
H00007364-M02-100ug
Species: Hu, Rt
Applications: WB, ELISA
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-80642
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for COMMD3 Recombinant Protein (H00023412-P02) (0)

There are no publications for COMMD3 Recombinant Protein (H00023412-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COMMD3 Recombinant Protein (H00023412-P02) (0)

There are no reviews for COMMD3 Recombinant Protein (H00023412-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COMMD3 Recombinant Protein (H00023412-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COMMD3 Products

Bioinformatics Tool for COMMD3 Recombinant Protein (H00023412-P02)

Discover related pathways, diseases and genes to COMMD3 Recombinant Protein (H00023412-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COMMD3 Recombinant Protein (H00023412-P02)

Discover more about diseases related to COMMD3 Recombinant Protein (H00023412-P02).
 

Pathways for COMMD3 Recombinant Protein (H00023412-P02)

View related products by pathway.

Research Areas for COMMD3 Recombinant Protein (H00023412-P02)

Find related products by research area.

Blogs on COMMD3

There are no specific blogs for COMMD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

COMMD3 Antibody
NBP1-88519

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human COMMD3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol COMMD3