Collagen XXI Antibody - BSA Free

Staining of human cell line ASC TERT1 shows localization to cytosol.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Collagen XXI Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Collagen XXI Antibody - BSA Free (NBP1-91015) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AKSSRFLTKIAVVLTDGKSQDDVKDAAQAARDSKITLFAIGVGSETEDAELRAIANKPSSTYVFYVEDYIAISKIREVMK
• Localization: Cytoplasm and cell membrane
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COL21A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Collagen XXI Protein (NBP1-91015PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Collagen XXI Antibody - BSA Free

• alpha 1 chain-like collagen
• alpha 1 type XXI collagen
• COL1AL
• COLA1L
• Collagen 21
• collagen alpha-1(XXI) chain
• collagen, type XXI, alpha 1
• Collagen-21
• dJ682J15.1
• dJ708F5.1
• DKFZp564B052
• FLJ39125
• FLJ44623
• MGC26619

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COL21A1
• Entrez:
  • 81578(Human)
• Uniprot:
  • Q96P44(Human)