Collagen XIII alpha 1 Antibody

Images

 
Western Blot: Collagen XIII alpha 1 Antibody [NBP2-13854] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: Collagen XIII alpha 1 Antibody [NBP2-13854] - Staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Collagen XIII alpha 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KGSKGEPGKGEMVDYNGNINEALQEIRTLALMGPPGLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COL13A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Collagen XIII alpha 1 Protein (NBP2-13854PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Collagen XIII alpha 1 Antibody

  • COL13A1
  • collagen alpha-1(XIII) chain
  • Collagen XIII alpha 1
  • collagen, type XIII, alpha 1
  • FLJ42485

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
AF550
Species: Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-30481
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
AF7109
Species: Mu
Applications: WB, IHC
AF2330
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-10373
Species: Hu
NBP2-33863
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
AF7279
Species: Hu, Mu
Applications: WB, ICC
NBP2-14915
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-42397
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13854
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Collagen XIII alpha 1 Antibody (NBP2-13854) (0)

There are no publications for Collagen XIII alpha 1 Antibody (NBP2-13854).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Collagen XIII alpha 1 Antibody (NBP2-13854) (0)

There are no reviews for Collagen XIII alpha 1 Antibody (NBP2-13854). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Collagen XIII alpha 1 Antibody (NBP2-13854) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Collagen XIII alpha 1 Products

Bioinformatics Tool for Collagen XIII alpha 1 Antibody (NBP2-13854)

Discover related pathways, diseases and genes to Collagen XIII alpha 1 Antibody (NBP2-13854). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Collagen XIII alpha 1 Antibody (NBP2-13854)

Discover more about diseases related to Collagen XIII alpha 1 Antibody (NBP2-13854).
 

Pathways for Collagen XIII alpha 1 Antibody (NBP2-13854)

View related products by pathway.

Blogs on Collagen XIII alpha 1

There are no specific blogs for Collagen XIII alpha 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Collagen XIII alpha 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COL13A1
Entrez