Collagen XIII alpha 1 Antibody - BSA Free

Western Blot: Collagen XIII alpha 1 Antibody [NBP2-13854] - Analysis in human cell lines PC-3 and Caco-2 using anti-COL13A1 antibody. Corresponding COL13A1 RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.

Western Blot: Collagen XIII alpha 1 Antibody [NBP2-13854] - MDA-MB-231 and MDA-MB-231-BrM2 whole cell lysates were loaded with 50 ug/lane. 10% SDS-PAGE. Collagen XIII alpha 1 Antibody (NBP2-13854) was used for primary antibody: 1:250, 4C, overnight. WB image submitted by a verified customer review.

Western Blot: Rabbit Polyclonal Collagen XIII alpha 1 Antibody [NBP2-13854] - MDA-MB-231 whole cell lysate was loaded with 100 ug/lane. 10% SDS-PAGE. Collagen XIII alpha 1 Antibody (NBP2-13854): 1:200, 4C, overnight. Image from a verified customer review.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Collagen XIII alpha 1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Collagen XIII alpha 1 Antibody - BSA Free (NBP2-13854) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KGSKGEPGKGEMVDYNGNINEALQEIRTLALMGPPGLP
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COL13A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.04-0.4 ug/ml
• Control Peptide:

  Collagen XIII alpha 1 Protein (NBP2-13854PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Collagen XIII alpha 1 Antibody - BSA Free

• COL13A1
• collagen alpha-1(XIII) chain
• Collagen XIII alpha 1
• collagen, type XIII, alpha 1
• FLJ42485

Background

COL13A1 encodes the alpha chain of one of the nonfibrillar collagens. The function of this gene product is not known, however, it has been detected at low levels in all connective tissue-producing cells so it may serve a general function in connective tissues. Unlike most of the collagens, which are secreted into the extracellular matrix, collagen XIII contains a transmembrane domain and the protein has been localized to the plasma membrane. The transcripts for this gene undergo complex and extensive splicing involving at least eight exons. Like other collagens, collagen XIII is a trimer; it is not known whether this trimer is composed of one or more than one alpha chain isomer. A number of alternatively spliced transcript variants have been described, but the full length nature of some of them has not been determined. Transcript Variant: This variant (1) encodes isoform 1. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The extent of this transcript is supported by transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Reviews for Collagen XIII alpha 1 Antibody (NBP2-13854) (2)

Average Rating: 5

(Based on 2 reviews)

We have 2 reviews tested in 1 species: Human.

reviewed by: Tina Huang WB Human 12/08/2023

Summary

• Application: Western Blot
• Sample Tested: MDA-MB-231
• Species: Human
• Lot: C117218

reviewed by: Yongkang Yang WB Human 09/12/2021

Summary

• Application: Western Blot
• Sample Tested: human MDAMB-231 whole cell lysate
• Species: Human
• Lot: 000021613

Bioinformatics

• Gene Symbol: COL13A1