Collagen VI alpha 1 Recombinant Protein Antigen

Images

 
There are currently no images for Collagen VI alpha 1 Recombinant Protein Antigen (NBP1-91195PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Collagen VI alpha 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COL6A1.

Source: E. coli

Amino Acid Sequence: VSVGIKDVFDFIPGSDQLNVISCQGLAPSQGRPGLSLVKENYAELLEDAFLKNVTAQICIDKKCPDYTCPITFSSPADITILLD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
COL6A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91195.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Collagen VI alpha 1 Recombinant Protein Antigen

  • Collagen 6
  • collagen alpha-1(VI) chain
  • collagen VI, alpha-1 polypeptide
  • collagen, type VI, alpha 1
  • Collagen-6
  • human mRNA for collagen VI alpha-1 C-terminal globular domain10alpha 1 (VI) chain (61 AA)
  • OPLL

Background

Collagens are highly conserved throughout evolution and are characterized by an uninterrupted "Glycine-X-Y" triplet repeat that is a necessary part of the triple helical structure. For these reasons it is often extremely difficult to generate antibodies with specificities to collagens. The development of type specific antibodies is dependent on NON-DENATURED three-dimensional epitopes. Collagens are extensively purified for immunization from human and bovine placenta and cartilage by limited pepsin digestion and selective salt precipitation. This preparation results in a native conformation of the protein. Antibodies are isolated from rabbit antiserum and are extensively cross-adsorbed by immunoaffinity purification to produce 'type' specific antibodies. Greatly diminished reactivity and selectivity of these antibodies will result if denaturing and reducing conditions of SDS-PAGE and immunoblotting are used.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001292-M01
Species: Hu, Po
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-75880
Species: Hu
Applications: ELISA
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF1936
Species: Hu
Applications: IP, WB
DY2037
Species: Hu
Applications: ELISA
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
NBP2-27561
Species: Ch, Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
DIP100
Species: Hu
Applications: ELISA
NBP1-91803
Species: Hu
Applications: IHC, IHC-P, WB
H00000730-D01P
Species: Hu, Mu
Applications: WB
H00005688-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NB600-408
Species: Bv, Hu, Mu, Po, Rb, Rt
Applications: ELISA, FLISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, MiAr, PAGE, WB
7954-GM/CF
Species: Hu
Applications: BA
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-34234
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB600-594
Species: Bv, Fe, Hu, Mu, Rt, Sh
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-76289
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for Collagen VI alpha 1 Recombinant Protein Antigen (NBP1-91195PEP) (0)

There are no publications for Collagen VI alpha 1 Recombinant Protein Antigen (NBP1-91195PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Collagen VI alpha 1 Recombinant Protein Antigen (NBP1-91195PEP) (0)

There are no reviews for Collagen VI alpha 1 Recombinant Protein Antigen (NBP1-91195PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Collagen VI alpha 1 Recombinant Protein Antigen (NBP1-91195PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Collagen VI alpha 1 Products

Research Areas for Collagen VI alpha 1 Recombinant Protein Antigen (NBP1-91195PEP)

Find related products by research area.

Blogs on Collagen VI alpha 1

There are no specific blogs for Collagen VI alpha 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Collagen VI alpha 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol COL6A1