Collagen VI alpha 1 Antibody [Alexa Fluor® 700]

Images

 

Product Details

Summary
Product Discontinued
View other related Collagen VI alpha 1 Primary Antibodies

Order Details


    • Catalog Number
      NBP3-38600AF700
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Collagen VI alpha 1 Antibody [Alexa Fluor® 700] Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 19-250 of human Collagen VI alpha 1 (NP_001839.2).

Sequence:
AQDEPETPRAVAFQDCPVDLFFVLDTSESVALRLKPYGALVDKVKSFTKRFIDNLRDRYYRCDRNLVWNAGALHYSDEVEIIQGLTRMPGGRDALKSSVDAVKYFGKGTYTDCAIKKGLEQLLVGGSHLKENKYLIVVTDGHPLEGYKEPCGGLEDAVNEAKHLGVKVFSVAITPDHLEPRLSIIATDHTYRRNFTAADWGQSRDAEEAISQTIDTIVDMIKNNVEQVCCSF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COL6A1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for Collagen VI alpha 1 Antibody [Alexa Fluor® 700]

  • Collagen 6
  • collagen alpha-1(VI) chain
  • collagen VI, alpha-1 polypeptide
  • collagen, type VI, alpha 1
  • Collagen-6
  • human mRNA for collagen VI alpha-1 C-terminal globular domain10alpha 1 (VI) chain (61 AA)
  • OPLL

Background

Collagens are highly conserved throughout evolution and are characterized by an uninterrupted "Glycine-X-Y" triplet repeat that is a necessary part of the triple helical structure. For these reasons it is often extremely difficult to generate antibodies with specificities to collagens. The development of type specific antibodies is dependent on NON-DENATURED three-dimensional epitopes. Collagens are extensively purified for immunization from human and bovine placenta and cartilage by limited pepsin digestion and selective salt precipitation. This preparation results in a native conformation of the protein. Antibodies are isolated from rabbit antiserum and are extensively cross-adsorbed by immunoaffinity purification to produce 'type' specific antibodies. Greatly diminished reactivity and selectivity of these antibodies will result if denaturing and reducing conditions of SDS-PAGE and immunoblotting are used.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001292-M01
Species: Hu, Po
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-75880
Species: Hu
Applications: ELISA
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF1936
Species: Hu
Applications: IP, WB
2150-C5
Species: Mu
Applications: BA
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
NBP2-27561
Species: Ch, Hu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
DIP100
Species: Hu
Applications: ELISA
NBP1-91803
Species: Hu
Applications: IHC,  IHC-P, WB
H00000730-D01P
Species: Hu, Mu
Applications: WB
H00005688-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
NB600-408
Species: Bv, Hu, Mu, Po, Rb, Rt
Applications: ELISA, FLISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, MiAr, PAGE, WB
7954-GM/CF
Species: Hu
Applications: BA
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-34234
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB600-594
Species: Bv, Fe, Hu, Mu, Rt, Sh
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-76289
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB

Publications for Collagen VI alpha 1 Antibody (NBP3-38600AF700) (0)

There are no publications for Collagen VI alpha 1 Antibody (NBP3-38600AF700).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Collagen VI alpha 1 Antibody (NBP3-38600AF700) (0)

There are no reviews for Collagen VI alpha 1 Antibody (NBP3-38600AF700). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Collagen VI alpha 1 Antibody (NBP3-38600AF700) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Collagen VI alpha 1 Products

Research Areas for Collagen VI alpha 1 Antibody (NBP3-38600AF700)

Find related products by research area.

Blogs on Collagen VI alpha 1

There are no specific blogs for Collagen VI alpha 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Collagen VI alpha 1 Antibody [Alexa Fluor® 700] and receive a gift card or discount.

Bioinformatics

Gene Symbol COL6A1