Collagen VI alpha 1 Antibody - BSA Free

Western Blot: Collagen VI Antibody [NBP1-59126] - Titration: 5% Milk, Positive Control: human LCL.

Western Blot: Collagen VI Antibody [NBP1-59126] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Product Discontinued

Collagen VI alpha 1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to COL6A1(collagen, type VI, alpha 1) The peptide sequence was selected from the middle region of COL6A1 (NP_001839). Peptide sequence ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COL6A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 108 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Collagen VI alpha 1 Antibody - BSA Free

• Collagen 6
• collagen alpha-1(VI) chain
• collagen VI, alpha-1 polypeptide
• collagen, type VI, alpha 1
• Collagen-6
• human mRNA for collagen VI alpha-1 C-terminal globular domain10alpha 1 (VI) chain (61 AA)
• OPLL

Background

COL6A1 is a collagen VI which acts as a cell-binding protein.Defects in COL6A1 are a cause of Bethlem myopathy (BM).The collagens are a superfamily of proteins that play a role in maintaining the integrity of various tissues. Collagens are extracellular matrix proteins and have a triple-helical domain as their common structural element. Collagen VI is a major structural component of microfibrils. The basic structural unit of collagen VI is a heterotrimer of the alpha1(VI), alpha2(VI), and alpha3(VI) chains. The alpha2(VI) and alpha3(VI) chains are encoded by the COL6A2 and COL6A3 genes, respectively. The protein encoded by this gene is the alpha 1 subunit of type VI collagen (alpha1(VI) chain). Mutations in the genes that code for the collagen VI subunits result in the autosomal dominant disorder, Bethlem myopathy. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. This gene, which encodes a neural small non-messenger RNA, is a member of the family of interspersed repetitive DNA, and its product represents an example of a primate tissue-specific RNA polymerase III transcript. The RNA sequence is divided into three domains: a 5' portion homologous to the Alu Lm, a central adenosine-rich region, and the terminal 43-nt nonrepetitive domain. It is believed that this gene was retropositionally generated and recruited into a function regulating dendritic protein biosynthesis. At least two pseudogenes of this gene have been identified. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-200 AF020057.2 4262-4461

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Collagen VI alpha 1 Antibody (NBP1-59126)(2)

Publications using NBP1-59126

• Sato T, Tokunaka K, Saiga K et al. Involvement of non triple helical type VI collagen alpha 1 chain, NTH alpha 1(VI), in the proliferation of cancer cells Oncol Rep 2020-08-13 [PMID: 33000277]
• McNeill EP, Zeitouni S, Pan S et al. Characterization of a pluripotent stem cell-derived matrix with powerful osteoregenerative capabilities Nat Commun 2020-06-15 [PMID: 32541821] (WB, Human)

Bioinformatics

• Gene Symbol: COL6A1
• Entrez:
  • 1291(Human)
• Uniprot:
  • P12109(Human)