Collagen V Antibody - BSA Free

Western Blot: Collagen V Antibody [NBP3-35507] - Western blot analysis of lysates from Saos-2 cells, using Collagen V Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Collagen V Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Collagen V Antibody - BSA Free (NBP3-35507) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human Collagen V (NP_000084.3).
  
  Sequence:
  LPPLLLLLLWAPPPSRAAQPADLLKVLDFHNLPDGITKTTGFCATRRSSKGPDVAYRVTKDAQLSAPTKQLYPASAFPEDFSILTTVKAKKGSQAFLVSIY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COL5A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 184 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Collagen V Antibody - BSA Free

• alpha 1 type V collagen
• Collagen 5
• collagen alpha-1(V) chain
• collagen, type V, alpha 1
• Collagen-5
• EC 2.7.7.6
• EC 6.1.1

Background

Type V collagen is a minor component of the connective tissue, although it is present in many different types of connective tissue. Patients with defects in the type V collagen (Ehlers-Danlos syndrome) have weakened connective tissue characterized by hyperstrechable joints and fragile, easily bruisable skin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COL5A1