Collagen IV Antibody (3V3N3)

Western Blot: Collagen IV Antibody (3V3N3) [NBP3-33471] - Western blot analysis of lysates from HeLa cells, using Collagen IV Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.

Dot Blot: Collagen IV Antibody (3V3N3) [NBP3-33471] - Dot-blot analysis of all sorts of peptides using Collagen IV Rabbit mAb antibody at 1:1000 dilution.

• Reactivity: Hu, Mu, Rt
• Applications: WB, DB, ELISA
• Clone: 3V3N3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Collagen IV Antibody (3V3N3) Summary

• Description: Novus Biologicals Rabbit Collagen IV Antibody (3V3N3) (NBP3-33471) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1573-1690 of human Collagen IV (NP_000083.3).
  
  Sequence:
  AQAVAVHSQDQSIPPCPQTWRSLWIGYSFLMHTGAGDQGGGQALMSPGSCLEDFRAAPFLECQGRQGTCHFFANKYSFWLTTVKADLQFSSAPAPDTLKESQAQRQKISRCQVCVKYS
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: COL4A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Dot Blot 1:500 - 1:1000
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 164 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Collagen IV Antibody (3V3N3)

• BSVD;BSVD1;COL4A1s;Collagen alpha-1(IV) chain;PADMAL;RATOR
• Collagen IV

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COL4A1