| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, DB, ELISA |
| Clone | 3V3N3 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1573-1690 of human Collagen IV (NP_000083.3). Sequence: AQAVAVHSQDQSIPPCPQTWRSLWIGYSFLMHTGAGDQGGGQALMSPGSCLEDFRAAPFLECQGRQGTCHFFANKYSFWLTTVKADLQFSSAPAPDTLKESQAQRQKISRCQVCVKYS |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | COL4A1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 164 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Collagen IV Antibody (NBP3-33471)Find related products by research area.
|
|
HSP Antibodies: Novel Therapies for MMP-induced Metastatic Breast Cancer The matrix metalloproteinases are zinc-dependent protease enzymes which interact with a range of ECM (extracellular matrix) proteins, and are activated by proteolytic cleavage. We at Novus Biologicals offer a wide range of top quality MMP reagents, in... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | COL4A1 |