Collagen II Antibody

Western Blot: Collagen II Antibody [NBP2-55511] - Analysis in human cell line HEK 293 and human cell line CACO-2.

Immunocytochemistry/Immunofluorescence: Collagen II Antibody [NBP2-55511] - Staining of human cell line HEK 293 shows localization to nucleoplasm. Antibody staining is shown in green.

Product Discontinued

Collagen II Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PGPGIDMSAFAGLGPREKGPDPLQYMRADQAAGGLRQHDAEVDATL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COL2A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Mouse 85%, Rat 87%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Collagen II Antibody

• Alpha-1 type II collagen
• ANFH
• AOM
• cartilage collagen
• Chondrocalcin
• COL11A3
• COL2A1
• Collagen 2
• collagen alpha-1(II) chain
• Collagen II
• collagen II, alpha-1 polypeptide
• collagen type 2
• collagen, type II, alpha 1 (primary osteoarthritis, spondyloepiphysealdysplasia, congenital)
• collagen, type II, alpha 1
• Collagen-2
• MGC131516
• SEDC

Background

The extensive family of COL gene products (collagens) is composed of several chain types, including fibril-forming interstitial collagens (types I, II, III and V) and basement membrane collagens (type IV), each type containing multiple isoforms. Collagens are fibrous, extracellular matrix proteins with high tensile strength and are the major components of connective tissue, such as tendons and cartilage. All collagens contain a triple helix domain and frequently show lateral self-association in order to form complex connective tissues. Several collagens also play a role in cell adhesion, important for maintaining normal tissue architecture and function. In cartilage, Collagen Type II constitutes the bulk of the fibril. Sensitization with Collagen Type II induces an erosive polyarthritis in rats, mice and higher primates which can resemble rheumatoid arthritis and relapsing polychrondritis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Collagen II Antibody (NBP2-55511)(2)

Publications using NBP2-55511

• Ge J, Yan Q, Wang Y, et al. IL-10 delays the degeneration of intervertebral discs by suppressing the p38 MAPK signaling pathway-10 protects intervertebral disc via p38 MAPK pathway Free Radic. Biol. Med. 2019-12-25 [PMID: 31883468] (WB, Human)
• Jing H, Zhang X, Luo K, et al. miR-381-abundant small extracellular vesicles derived from kartogenin-preconditioned mesenchymal stem cells promote chondrogenesis of MSCs by targeting TAOK1 Biomaterials 2020-02-01 [PMID: 31864017] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: COL2A1