COL14A1 Antibody (5F3)

Images

 
Sandwich ELISA: COL14A1 Antibody (5F3) [H00007373-M01] - Detection limit for recombinant GST tagged COL14A1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5F3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

COL14A1 Antibody (5F3) Summary

Immunogen
COL14A1 (NP_066933, 34 a.a. - 120 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TRLRYNVISHDSIQISWKAPRGKFGGYKLLVTPTSGGKTNQLNLQNTATKAIIQGLMPDQNYTVQIIAYNKDKESKPAQGQFRIKDL
Localization
Secreted, extracellular space, extracellular matrix.
Specificity
COL14A1 - collagen, type XIV, alpha 1 (undulin)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
COL14A1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for COL14A1 Antibody (5F3)

  • collagen alpha-1(XIV) chain
  • collagen, type XIV, alpha 1
  • undulin (fibronectin-tenascin-related)
  • Undulin
  • UNDundulin

Background

COL14A1 (Collagen, Type XIV, alpha 1) also known as undulin is a large glycoprotein of the interstitial extracellular matrix, which plays a role in integrating collagen bundles. It is associated with mature interstitial collagen fibrils.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
H00010411-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-88062
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
AF3795
Species: Hu
Applications: WB, IP
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00007373-M01
Species: Hu
Applications: WB, ELISA

Publications for COL14A1 Antibody (H00007373-M01) (0)

There are no publications for COL14A1 Antibody (H00007373-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COL14A1 Antibody (H00007373-M01) (0)

There are no reviews for COL14A1 Antibody (H00007373-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COL14A1 Antibody (H00007373-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COL14A1 Products

Bioinformatics Tool for COL14A1 Antibody (H00007373-M01)

Discover related pathways, diseases and genes to COL14A1 Antibody (H00007373-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COL14A1 Antibody (H00007373-M01)

Discover more about diseases related to COL14A1 Antibody (H00007373-M01).
 

Pathways for COL14A1 Antibody (H00007373-M01)

View related products by pathway.

PTMs for COL14A1 Antibody (H00007373-M01)

Learn more about PTMs related to COL14A1 Antibody (H00007373-M01).

Blogs on COL14A1

There are no specific blogs for COL14A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COL14A1 Antibody (5F3) and receive a gift card or discount.

Bioinformatics

Gene Symbol COL14A1
Entrez
OMIM
Uniprot