Cofilin 2 Antibody (6G9)

Images

 
Western Blot: Cofilin 2 Antibody (6G9) [H00001073-M03] - Analysis of CFL2 expression in HeLa (Cat # L013V1).
Immunocytochemistry/ Immunofluorescence: Cofilin 2 Antibody (6G9) [H00001073-M03] - Analysis of monoclonal antibody to CFL2 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: Cofilin 2 Antibody (6G9) [H00001073-M03] - Analysis of monoclonal antibody to CFL2 on formalin-fixed paraffin-embedded human skeletal muscle. Antibody concentration 8 ug/ml
ELISA: Cofilin 2 Antibody (6G9) [H00001073-M03] - Detection limit for recombinant GST tagged CFL2 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
6G9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cofilin 2 Antibody (6G9) Summary

Immunogen
CFL2 (NP_068733, 57 a.a. - 166 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
Specificity
CFL2 - cofilin 2 (muscle)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CFL2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cofilin 2 Antibody (6G9)

  • cofilin 2 (muscle)
  • Cofilin, muscle isoform
  • cofilin-2
  • NEM7

Background

Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. (Gillett et al., 1996 [PubMed 8800436]). Cofilin-2 is a member of the AC group of proteins that also includes cofilin-1 (CFL1) and destrin (DSTN; MIM 609114), all of which regulate actin-filament dynamics (Bamburg et al., 1999 [PubMed 10461190]; Maciver and Hussey, 2002). The CFL2 gene encodes a skeletal muscle-specific isoform (Vartiainen et al., 2002 [PubMed 11809832]) localized to the thin filaments, where it exerts its effect on actin, in part through interactions with tropomyosins (Ono and Ono, 2002 [PubMed 11901171]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00001072-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
H00006944-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11099
Species: Hu, Mu, Rt, Po, Al, Am, Av, Bv, Ch, Fi, Rb
Applications: WB, ICC/IF
NBP2-52983
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-66943
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-74340
Species: Hu, Mu, Rt, Bv, ChHa, Dr, Fu, Pl, Pr, Rb, Sh, Xp, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P, IP, PEP-ELISA
NBP1-91865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-507
Species: Hu, Mu, Rt, Rb
Applications: WB, PEP-ELISA
NBP1-85783
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001073-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for Cofilin 2 Antibody (H00001073-M03) (0)

There are no publications for Cofilin 2 Antibody (H00001073-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cofilin 2 Antibody (H00001073-M03) (0)

There are no reviews for Cofilin 2 Antibody (H00001073-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cofilin 2 Antibody (H00001073-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Cofilin 2 Antibody (H00001073-M03)

Discover related pathways, diseases and genes to Cofilin 2 Antibody (H00001073-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cofilin 2 Antibody (H00001073-M03)

Discover more about diseases related to Cofilin 2 Antibody (H00001073-M03).
 

Pathways for Cofilin 2 Antibody (H00001073-M03)

View related products by pathway.

PTMs for Cofilin 2 Antibody (H00001073-M03)

Learn more about PTMs related to Cofilin 2 Antibody (H00001073-M03).

Blogs on Cofilin 2

There are no specific blogs for Cofilin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cofilin 2 Antibody (6G9) and receive a gift card or discount.

Bioinformatics

Gene Symbol CFL2
Entrez
OMIM
Uniprot