LIM kinase 2 Antibody

Images

 
Western Blot: LIM kinase 2 Antibody [NBP1-85783] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: LIM kinase 2 Antibody [NBP1-85783] - Staining of human cell line U-251MG shows positivity in cytoplasm and mitochondria.
Immunohistochemistry-Paraffin: LIM kinase 2 Antibody [NBP1-85783] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
Western Blot: LIM kinase 2 Antibody [NBP1-85783] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LIM kinase 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VEEVEDAISQTSQTLQLLIEHDPVSQRLDQLRLEARLAPHMQNAGHPHALSTLDTKENLEGTLRRRSLRRSNSISKSPGPSSPKEPLLFSRDISRSESLRCSSSYSQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LIMK2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LIM kinase 2 Protein (NBP1-85783PEP)
Publications
Read Publications using
NBP1-85783 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LIM kinase 2 Antibody

  • EC 2.7.11.1
  • LIM domain kinase 2
  • LIMK-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003984-M01A
Species: Hu, Mu, Rt
Applications: WB, ELISA, IF
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-624
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56159
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85802
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88680
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26616
Species: Hu
Applications: WB, IP
NB110-94452
Species: Hu, Ch, Mu(-), Rt(-)
Applications: WB, ICC/IF
NBP1-85783
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LIM kinase 2 Antibody (NBP1-85783)(2)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for LIM kinase 2 Antibody (NBP1-85783) (0)

There are no reviews for LIM kinase 2 Antibody (NBP1-85783). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LIM kinase 2 Antibody (NBP1-85783) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LIM kinase 2 Products

Bioinformatics Tool for LIM kinase 2 Antibody (NBP1-85783)

Discover related pathways, diseases and genes to LIM kinase 2 Antibody (NBP1-85783). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LIM kinase 2 Antibody (NBP1-85783)

Discover more about diseases related to LIM kinase 2 Antibody (NBP1-85783).
 

Pathways for LIM kinase 2 Antibody (NBP1-85783)

View related products by pathway.

PTMs for LIM kinase 2 Antibody (NBP1-85783)

Learn more about PTMs related to LIM kinase 2 Antibody (NBP1-85783).
 

Research Areas for LIM kinase 2 Antibody (NBP1-85783)

Find related products by research area.

Blogs on LIM kinase 2

There are no specific blogs for LIM kinase 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LIM kinase 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LIMK2