COCO/DAND5 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: COCO/DAND5 Antibody [NBP2-68651] - Staining of human cell line SH-SY5Y shows localization to mitochondria.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

COCO/DAND5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DAND5
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for COCO/DAND5 Antibody - BSA Free

• CER2CRL2
• Cerberus 2
• Cerberus like-2
• cerberus-like 2
• Cerberus-like protein 2
• CERL2
• cerl-2
• CKTSF1B3
• CKTSF1B3MGC126849
• COCO
• Cysteine knot superfamily 1, BMP antagonist 3
• DAN domain family member 5
• DAN domain family, member 5
• DAND5
• Dante
• DTE
• FLJ38607
• GREM3
• GREM3cerberus 2
• gremlin-3
• SP1

Background

DAND5, also known as DAN domain family member 5, is a 20 kDa 189 amino acid protein that forms homodimers and heterodimers as a member of the BMP antagonist family. Current research involving the protein includes connections with syrigoma, myopia, norrie disease, astigmatism, and carcinoma. The protein also plays important roles in tissue growth and differentiation pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DAND5