COBRA1 Antibody

Images

 
Western Blot: COBRA1 Antibody [NBP1-82924] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: COBRA1 Antibody [NBP1-82924] - Saining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Western Blot: COBRA1 Antibody [NBP1-82924] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Orthogonal Strategies: Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924] - Analysis in human skin and liver tissues. Corresponding NELFB RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924] - Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924] - Staining of human liver shows no positivity in hepatocytes.
Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924] - Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

COBRA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KETLTNCTEPLKAIEQFQTENGVLLPSLQSALPFLDLHGTPRLEFHQSVFDELRDKLLERVSAIASEGKAEERYKKLED
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COBRA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COBRA1 Protein (NBP1-82924PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-82924 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COBRA1 Antibody

  • cofactor of BRCA1DKFZp586B0519
  • KIAA1182negative elongation factor B
  • NELFB
  • NELF-Bnegative elongation factor protein B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-81759
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP1-90813
Species: Hu
Applications: IHC, IHC-P, WB
H00051497-B01P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00051176-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, KD, PLA, S-ELISA, WB
NBP2-67710
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89544
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88036
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-67569
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-19560
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
MAB2018
Species: Hu, Mu, Rt
Applications: CyTOF-reported, ICC, ICFlow, Simple Western, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NBP2-37394
Species: Hu, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
H00388112-B01P
Species: Hu
Applications: WB
NBP1-82924
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for COBRA1 Antibody (NBP1-82924) (0)

There are no publications for COBRA1 Antibody (NBP1-82924).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for COBRA1 Antibody (NBP1-82924) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-82924:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot COBRA1 NBP1-82924
Enlarge
4
reviewed by:
Verified Customer
WB Human 09/25/2015
View

Summary

ApplicationWestern Blot
Sample TestedFibroblasts
SpeciesHuman
LotR10543

Blocking

Blocking Details5% Milk/TBS-T, 1 hour, room temperature

Primary Anitbody

Dilution Ratio1:200, overnight, 4C 5% Milk/TBS-T

Secondary Antibody

Secondary DescriptionRabbit IgG, HRP-linked whole Ab (from donkey)
Secondary Manufacturer Cat#NA934-100UL
Secondary Concentration1:5000

Details

Detection NotesPierce ECL reagent

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for COBRA1 Antibody (NBP1-82924) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COBRA1 Products

Bioinformatics Tool for COBRA1 Antibody (NBP1-82924)

Discover related pathways, diseases and genes to COBRA1 Antibody (NBP1-82924). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COBRA1 Antibody (NBP1-82924)

Discover more about diseases related to COBRA1 Antibody (NBP1-82924).
 

Pathways for COBRA1 Antibody (NBP1-82924)

View related products by pathway.

PTMs for COBRA1 Antibody (NBP1-82924)

Learn more about PTMs related to COBRA1 Antibody (NBP1-82924).

Blogs on COBRA1.

COBRA1: A Key Player in Transcriptional Pausing
Co-factor of BRCA1, also known as COBRA1, was first identified as a protein that binds to the tumour suppressor protein encoded by the breast cancer susceptibility gene BRCA1 (1). It was subsequently found to be identical to subunit B of the Negative ...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Verified Customer
09/25/2015
Application: WB
Species: Human

Bioinformatics

Gene Symbol COBRA1