COBRA1 Antibody


Western Blot: COBRA1 Antibody [NBP1-82924] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: COBRA1 Antibody [NBP1-82924] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Orthogonal Strategies: Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924] - Staining in human fallopian tube and liver tissues using anti-NELFB antibody. Corresponding NELFB RNA-seq data are presented more
Western Blot: COBRA1 Antibody [NBP1-82924] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924] - Staining of human small intestine shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924] - Staining of human liver shows low expression as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

COBRA1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KETLTNCTEPLKAIEQFQTENGVLLPSLQSALPFLDLHGTPRLEFHQSVFDELRDKLLERVSAIASEGKAEERYKKLED
Specificity of human, mouse, rat COBRA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COBRA1 Protein (NBP1-82924PEP)
Reviewed Applications
Read 1 Review rated 4
NBP1-82924 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for COBRA1 Antibody

  • cofactor of BRCA1DKFZp586B0519
  • KIAA1182negative elongation factor B
  • NELF-Bnegative elongation factor protein B


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
Species: Hu
Applications: WB, ELISA

Publications for COBRA1 Antibody (NBP1-82924) (0)

There are no publications for COBRA1 Antibody (NBP1-82924).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for COBRA1 Antibody (NBP1-82924) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-82924:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot COBRA1 NBP1-82924
reviewed by:
WB Human 09/25/2015


ApplicationWestern Blot
Sample TestedFibroblasts


Blocking Details5% Milk/TBS-T, 1 hour, room temperature

Primary Anitbody

Dilution Ratio1:200, overnight, 4C 5% Milk/TBS-T

Secondary Antibody

Secondary DescriptionRabbit IgG, HRP-linked whole Ab (from donkey)
Secondary Manufacturer Cat#NA934-100UL
Secondary Concentration1:5000


Detection NotesPierce ECL reagent

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for COBRA1 Antibody (NBP1-82924) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for COBRA1 Antibody (NBP1-82924)

Discover related pathways, diseases and genes to COBRA1 Antibody (NBP1-82924). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COBRA1 Antibody (NBP1-82924)

Discover more about diseases related to COBRA1 Antibody (NBP1-82924).

Pathways for COBRA1 Antibody (NBP1-82924)

View related products by pathway.

PTMs for COBRA1 Antibody (NBP1-82924)

Learn more about PTMs related to COBRA1 Antibody (NBP1-82924).

Blogs on COBRA1.

COBRA1: A Key Player in Transcriptional Pausing
Co-factor of BRCA1, also known as COBRA1, was first identified as a protein that binds to the tumour suppressor protein encoded by the breast cancer susceptibility gene BRCA1 (1). It was subsequently found to be identical to subunit B of the Negative...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: WB
Species: Human


Gene Symbol COBRA1