COBRA1 Antibody

Images

 
Western Blot: COBRA1 Antibody [NBP1-82924] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: COBRA1 Antibody [NBP1-82924] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: COBRA1 Antibody [NBP1-82924] - Staining of human small intestine shows strong nuclear positivity in glandular cells.
Western Blot: COBRA1 Antibody [NBP1-82924] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COBRA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KETLTNCTEPLKAIEQFQTENGVLLPSLQSALPFLDLHGTPRLEFHQSVFDELRDKLLERVSAIASEGKAEERYKKLED
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COBRA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COBRA1 Protein (NBP1-82924PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-82924 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COBRA1 Antibody

  • cofactor of BRCA1DKFZp586B0519
  • KIAA1182negative elongation factor B
  • NELFB
  • NELF-Bnegative elongation factor protein B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92175
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-90813
Species: Hu
Applications: WB, IHC, IHC-P
H00051497-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88036
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP2-19560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP2-37394
Species: Hu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
H00388112-B01P
Species: Hu
Applications: WB, ELISA

Publications for COBRA1 Antibody (NBP1-82924) (0)

There are no publications for COBRA1 Antibody (NBP1-82924).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for COBRA1 Antibody (NBP1-82924) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-82924:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot COBRA1 NBP1-82924
Enlarge
reviewed by:
Anonymous
WB Human 09/25/2015
View

Summary

ApplicationWestern Blot
Sample TestedFibroblasts
SpeciesHuman
LotR10543

Blocking

Blocking Details5% Milk/TBS-T, 1 hour, room temperature

Primary Anitbody

Dilution Ratio1:200, overnight, 4C 5% Milk/TBS-T

Secondary Antibody

Secondary DescriptionRabbit IgG, HRP-linked whole Ab (from donkey)
Secondary Manufacturer Cat#NA934-100UL
Secondary Concentration1:5000

Details

Detection NotesPierce ECL reagent

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for COBRA1 Antibody (NBP1-82924) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COBRA1 Products

Bioinformatics Tool for COBRA1 Antibody (NBP1-82924)

Discover related pathways, diseases and genes to COBRA1 Antibody (NBP1-82924). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COBRA1 Antibody (NBP1-82924)

Discover more about diseases related to COBRA1 Antibody (NBP1-82924).
 

Pathways for COBRA1 Antibody (NBP1-82924)

View related products by pathway.

PTMs for COBRA1 Antibody (NBP1-82924)

Learn more about PTMs related to COBRA1 Antibody (NBP1-82924).

Blogs on COBRA1.

COBRA1: A Key Player in Transcriptional Pausing
Co-factor of BRCA1, also known as COBRA1, was first identified as a protein that binds to the tumour suppressor protein encoded by the breast cancer susceptibility gene BRCA1 (1). It was subsequently found to be identical to subunit B of the Negative...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
09/25/2015
Application: WB
Species: Human

Bioinformatics

Gene Symbol COBRA1