COBL Antibody - BSA Free

Immunohistochemistry-Paraffin: COBL Antibody [NBP1-89615] - Staining in human parathyroid gland and smooth muscle tissues using anti-COBL antibody. Corresponding COBL RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: COBL Antibody [NBP1-89615] - Staining of human cerebral cortex, colon, heart muscle and smooth muscle using Anti-COBL antibody NBP1-89615 (A) shows similar protein distribution across tissues to independent antibody NBP1-89616 (B).

Western Blot: COBL Antibody [NBP1-89615] - Analysis in HeLa cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-COBL antibody. Remaining relative intensity is presented. Loading control: anti-GAPDH.

Immunocytochemistry/Immunofluorescence: COBL Antibody [NBP1-89615] - Validation of the LCM/MS data from cellular protrusions using microscopy. Tenm2 is found within COBL in growth cones. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30866487/) licensed under a CC-BY license.

Immunohistochemistry-Paraffin: COBL Antibody [NBP1-89615] - Staining of human smooth muscle using Anti-COBL antibody NBP1-89615.

Immunocytochemistry/Immunofluorescence: COBL Antibody [NBP1-89615] - Staining of human cell line CACO-2 shows localization to nucleoplasm & cell junctions. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: COBL Antibody [NBP1-89615] - Staining of human parathyroid gland shows high expression.

Immunohistochemistry-Paraffin: COBL Antibody [NBP1-89615] - Staining of human smooth muscle shows low expression as expected.

Immunohistochemistry-Paraffin: COBL Antibody [NBP1-89615] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: COBL Antibody [NBP1-89615] - Staining of human colon.

Immunohistochemistry-Paraffin: COBL Antibody [NBP1-89615] - Staining of human heart muscle.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

COBL Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AVVRVSPEVPLQNILPVICAKCEVSPEHVVLLRDNIAGEELELSKSLNELGIKELYAWDNRRETFRKSSLGNDETDKEKKKFLGFFKVNKRSNSKGCLT
• Predicted Species: Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COBL
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  COBL Protein (NBP1-89615PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30866487).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for COBL Antibody - BSA Free

• cordon-bleu WH2 repeat protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for COBL Antibody (NBP1-89615)(1)

Publication using NBP1-89615

• Gousset K, Gordon A, Kumar Kannan S, Tovar J. A novel Microproteomic Approach Using Laser Capture Microdissection to Study Cellular Protrusions Int J Mol Sci 2019-03-07 [PMID: 30866487] (ICC/IF, Mouse)

Bioinformatics

• Gene Symbol: COBL