Prothrombin Antibody - BSA Free

721_B tissue lysate at a concentration of 1ug/ml.

Immunohistochemistry: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Analysis of human liver after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.

Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Human Placenta Tissue

Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Human Placenta Tissue, 5.0ug/ml.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Prothrombin Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to F2(coagulation factor II (thrombin)) The peptide sequence was selected from the middle region of F2 (NP_000497). Peptide sequence ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: F2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 5 ug/ml
  • Western Blot 1.0 ug/ml
• Theoretical MW: 70 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30846818).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Prothrombin Antibody - BSA Free

• coagulation factor II (thrombin)
• Coagulation factor II
• EC 3.4.21
• EC 3.4.21.5
• prothrombin B-chain
• prothrombin
• PT
• serine protease

Background

Coagulation factor II is proteolytically cleaved to form thrombin in the first step of the coagulation cascade which ultimately results in the stemming of blood loss. F2 also plays a role in maintaining vascular integrity during development and postnatal life.Coagulation factor II is proteolytically cleaved to form thrombin in the first step of the coagulation cascade which ultimately results in the stemming of blood loss. F2 also plays a role in maintaining vascular integrity during development and postnatal life. Mutations in F2 leads to various forms of thrombosis and dysprothrombinemia. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Coagulation Factor II/Thrombin Antibody (NBP1-58268)(3)

Publications using NBP1-58268

• Nishimura F, Mogami H, Moriuchi K et al. Mechanisms of thrombin-Induced myometrial contractions: Potential targets of progesterone PLoS ONE 2020-05-04 [PMID: 32365105] (IHC-P, Human)
• Grant DM, Macedo A, Toms D, Klein C Fibrinogen in equine pregnancy as a mediator of cell adhesion, an epigenetic and functional investigation Biol. Reprod. 2019-08-12 [PMID: 31403677]
• Posthuma Jelle J, Posma Jens J N, Van Oerle Rene et al. Targeting Coagulation Factor Xa Promotes Regression of Advanced Atherosclerosis in Apolipoprotein-E Deficient Mice. Sci Rep. 2019-03-07 [PMID: 30846818] (IHC-P, Mouse)

Review for Coagulation Factor II/Thrombin Antibody (NBP1-58268) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Equine.

reviewed by: Claudia Klein IHC-P Equine 07/14/2017

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: Placental tissue
• Species: Equine

Comments

• Comments: Heat mediated antigen retrieval (sodium-citrate based buffer) for 10 min.

Bioinformatics

• Gene Symbol: F2
• Entrez:
  • 2147(Human)
• Uniprot:
  • P00734()