Coagulation Factor II/Thrombin Antibody


Western Blot: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - 721_B tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Analysis of human liver after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Human Placenta Tissue
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Human Placenta Tissue, 5.0ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Coagulation Factor II/Thrombin Antibody Summary

Synthetic peptides corresponding to F2(coagulation factor II (thrombin)) The peptide sequence was selected from the middle region of F2 (NP_000497). Peptide sequence ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1 ug/ml
  • Immunohistochemistry 5 ug/ml
  • Immunohistochemistry-Paraffin 5 ug/ml
Theoretical MW
70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 5
NBP1-58268 in the following applications:

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Coagulation Factor II/Thrombin Antibody

  • coagulation factor II (thrombin) receptor-like 2
  • Coagulation factor II receptor-like 2 (protease-actovated receptor 3)
  • Coagulation factor II receptor-like 2
  • Coagulation Factor II
  • F2
  • PAR-3
  • PAR3proteinase-activated receptor 3
  • protease-activated receptor 3
  • proteinase-activated receptor-3
  • PT
  • serine protease
  • Thrombin receptor-like 2
  • Thrombin


Coagulation factor II is proteolytically cleaved to form thrombin in the first step of the coagulation cascade which ultimately results in the stemming of blood loss. F2 also plays a role in maintaining vascular integrity during development and postnatal life.Coagulation factor II is proteolytically cleaved to form thrombin in the first step of the coagulation cascade which ultimately results in the stemming of blood loss. F2 also plays a role in maintaining vascular integrity during development and postnatal life. Mutations in F2 leads to various forms of thrombosis and dysprothrombinemia. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, Neut
Species: Hu, Ba
Applications: WB, ELISA
Species: Hu, Rt
Applications: WB, ELISA, IHC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Coagulation Factor II/Thrombin Antibody (NBP1-58268) (0)

There are no publications for Coagulation Factor II/Thrombin Antibody (NBP1-58268).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Coagulation Factor II/Thrombin Antibody (NBP1-58268) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Equine.

Reviews using NBP1-58268:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin Coagulation Factor II/Thrombin NBP1-58268
reviewed by:
Claudia Klein
IHC-P Equine 07/14/2017


Sample TestedPlacental tissue


CommentsHeat mediated antigen retrieval (sodium-citrate based buffer) for 10 min.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Coagulation Factor II/Thrombin Antibody (NBP1-58268). (Showing 1 - 1 of 1 FAQ).

  1. Do you have neutralizing antibodies for anti-mouse Thrombin?
    • We currently have 1 neutralizing Thrombin antibody (NBP1-95029), however it is an anti-human antibody and has only been validated in human samples. If you would like to test this antibody in mouse samples, you may be interested in participating in our Innovators Reward Program.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Coagulation Factor II/Thrombin Antibody (NBP1-58268)

Discover related pathways, diseases and genes to Coagulation Factor II/Thrombin Antibody (NBP1-58268). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Coagulation Factor II/Thrombin Antibody (NBP1-58268)

Discover more about diseases related to Coagulation Factor II/Thrombin Antibody (NBP1-58268).

Pathways for Coagulation Factor II/Thrombin Antibody (NBP1-58268)

View related products by pathway.

PTMs for Coagulation Factor II/Thrombin Antibody (NBP1-58268)

Learn more about PTMs related to Coagulation Factor II/Thrombin Antibody (NBP1-58268).

Blogs on Coagulation Factor II/Thrombin

There are no specific blogs for Coagulation Factor II/Thrombin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Claudia Klein
Application: IHC-P
Species: Equine


Gene Symbol F2