CNPase Antibody (2887)

Images

 
Western Blot: CNPase Antibody (2887) [NBP2-46617] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Mouse Cerebral Cortex tissue
Immunohistochemistry: CNPase Antibody (2887) [NBP2-46617] - Staining of human pancreas shows absence of immunoreactivity (negative control).
Western Blot: CNPase Antibody (2887) [NBP2-46617] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human Cerebral Cortex tissue
Immunohistochemistry: CNPase Antibody (2887) [NBP2-46617] - Staining of rat cerebral cortex shows strong immunoreactivity in single oligodendrocytes.
Immunohistochemistry: CNPase Antibody (2887) [NBP2-46617] - Staining of mouse cerebral cortex shows strong immunoreactivity in oligodendrocytes.
Immunohistochemistry: CNPase Antibody (2887) [NBP2-46617] - Staining of human cerebral cortex shows strong immunoreactivity in oligodendrocytes.
Immunohistochemistry: CNPase Antibody (2887) [NBP2-46617] - Staining of rat hippocampal formation shows strong immunoreactivity in oligodendrocytes and myelinated fibers.
Immunohistochemistry: CNPase Antibody (2887) [NBP2-46617] - Staining of mouse amygdala shows strong immunoreactivity in oligodendrocytes.
Immunohistochemistry: CNPase Antibody (2887) [NBP2-46617] - Staining of human cerebellum shows strong immunoreactivity in oligodendrocytes and myelinated neural fibers.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clone
2887
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CNPase Antibody (2887) Summary

Immunogen
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSKAFTLTISALFVTPKTTGARVELSEQQLQLWPSDVDKLSPTDNLPRGSRAHITL
Epitope
Binds to an epitope located within the peptide sequence LSEQQLQLWPSDVDK as determined by overlapping synthetic peptides.
Specificity
Specificity of human, mouse, rat CNPase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG2b
Clonality
Monoclonal
Host
Mouse
Gene
CNP
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
CNPase Lysate (NBP2-64872)

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for CNPase Antibody (2887)

  • 2', 3' cyclic nucleotide 3' phosphohydrolase
  • 2'-3'-cyclic nucleotide 3' phosphodiesterase
  • 2'-3'-cyclic-nucleotide 3'-phosphodiesterase
  • CNP1
  • CNPase
  • EC 3.1.4.37

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-46201
Species: Hu
Applications: WB, IHC
H00004882-M02
Species: Hu, Po
Applications: WB, ELISA, IHC-P
NBP1-31333
Species: Hu, Rt, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-22568
Species: Hu
Applications: IHC-P
NBP1-88573
Species: Hu
Applications: WB, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31365
Species: Hu, Mu, Ch, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
H00004340-B01P
Species: Hu, Rt
Applications: WB

Publications for CNPase Antibody (NBP2-46617) (0)

There are no publications for CNPase Antibody (NBP2-46617).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNPase Antibody (NBP2-46617) (0)

There are no reviews for CNPase Antibody (NBP2-46617). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CNPase Antibody (NBP2-46617) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CNPase Antibody (NBP2-46617)

Discover related pathways, diseases and genes to CNPase Antibody (NBP2-46617). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNPase Antibody (NBP2-46617)

Discover more about diseases related to CNPase Antibody (NBP2-46617).
 

Pathways for CNPase Antibody (NBP2-46617)

View related products by pathway.

PTMs for CNPase Antibody (NBP2-46617)

Learn more about PTMs related to CNPase Antibody (NBP2-46617).
 

Research Areas for CNPase Antibody (NBP2-46617)

Find related products by research area.

Blogs on CNPase

There are no specific blogs for CNPase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CNPase Antibody (2887) and receive a gift card or discount.

Bioinformatics

Gene Symbol CNP
Entrez
Uniprot