CNOT8 Antibody


Immunohistochemistry-Paraffin: CNOT8 Antibody [NBP2-13849] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

CNOT8 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: CGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CNOT8 Protein (NBP2-13849PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CNOT8 Antibody

  • CAF1
  • CAF2
  • CALIFCAF1-like protein
  • CALIFp
  • CCR4-NOT transcription complex subunit 8
  • CCR4-NOT transcription complex, subunit 8
  • hCAF1
  • PGK promoter directed over production
  • POP2CCR4-associated factor 8


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, CyTOF-reported
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IP
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for CNOT8 Antibody (NBP2-13849) (0)

There are no publications for CNOT8 Antibody (NBP2-13849).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNOT8 Antibody (NBP2-13849) (0)

There are no reviews for CNOT8 Antibody (NBP2-13849). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CNOT8 Antibody (NBP2-13849) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CNOT8 Products

Bioinformatics Tool for CNOT8 Antibody (NBP2-13849)

Discover related pathways, diseases and genes to CNOT8 Antibody (NBP2-13849). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNOT8 Antibody (NBP2-13849)

Discover more about diseases related to CNOT8 Antibody (NBP2-13849).

Pathways for CNOT8 Antibody (NBP2-13849)

View related products by pathway.

PTMs for CNOT8 Antibody (NBP2-13849)

Learn more about PTMs related to CNOT8 Antibody (NBP2-13849).

Blogs on CNOT8

There are no specific blogs for CNOT8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CNOT8 Antibody and receive a gift card or discount.


Gene Symbol CNOT8