Novus Biologicals products are now on bio-techne.com

BTG3 Antibody

Images

 
Western Blot: BTG3 Antibody [NBP1-89098] - Analysis in control (vector only transfected HEK293T lysate) and BTG3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: BTG3 Antibody [NBP1-89098] - Staining of human pancreas shows distinct cytoplasmic positivity in exocrine glandular cells along with extracellular material.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BTG3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VDPCEVCCRYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVT
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BTG3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BTG3 Protein (NBP1-89098PEP)
Publications
Read Publication using NBP1-89098.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BTG3 Antibody

  • Abundant in neuroepithelium area protein
  • ANATOB55
  • B-cell translocation gene 3
  • B-cell translocation gene10
  • BTG family member 3
  • BTG family, member 3
  • MGC8928
  • protein BTG3
  • Protein Tob5
  • tob55
  • TOB5TOFA

Background

The protein encoded by the BTG3 gene is a member of the BTG/Tob family. This family has structurally related proteins thatappear to have antiproliferative properties. This encoded protein might play a role in neurogenesis in the centralnervous system. Two transcript variants encoding different isoforms have been found for this gene. (provided byRefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46587
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF5228
Species: Hu
Applications: WB
NBP2-15930
Species: Hu
Applications: ICC/IF, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
MAB6898
Species: Hu, Mu
Applications: WB
NBP2-46586
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
7398-FS
Species: Hu
Applications: BA
NBP1-84509
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
H00054766-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-24619
Species: Bv, Ca, Ch, Eq, Hu, Mu, Pm
Applications: WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-84597
Species: Hu
Applications: IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB100-695
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, Simple Western, WB
H00005122-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP2-15275
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83224
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00029883-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-67899
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB

Publications for BTG3 Antibody (NBP1-89098)(1)

Reviews for BTG3 Antibody (NBP1-89098) (0)

There are no reviews for BTG3 Antibody (NBP1-89098). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BTG3 Antibody (NBP1-89098) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BTG3 Products

Research Areas for BTG3 Antibody (NBP1-89098)

Find related products by research area.

Blogs on BTG3

There are no specific blogs for BTG3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BTG3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BTG3