BTG3 Antibody

Images

 
Western Blot: BTG3 Antibody [NBP1-89098] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: BTG3 Antibody [NBP1-89098] - Staining of human pancreas shows distinct cytoplasmic positivity in exocrine glandular cells along with extracellular material.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BTG3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VDPCEVCCRYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BTG3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BTG3 Protein (NBP1-89098PEP)
Publications
Read Publication using NBP1-89098.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23657964)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BTG3 Antibody

  • Abundant in neuroepithelium area protein
  • ANATOB55
  • B-cell translocation gene 3
  • B-cell translocation gene10
  • BTG family member 3
  • BTG family, member 3
  • MGC8928
  • protein BTG3
  • Protein Tob5
  • tob55
  • TOB5TOFA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81215
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5228
Species: Hu
Applications: WB
NBP2-15930
Species: Hu
Applications: WB, ICC/IF
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF6898
Species: Hu, Mu, Rt
Applications: WB
NBP2-46586
Species: Hu
Applications: IHC
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84509
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00054766-M07
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24619
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-84597
Species: Hu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-695
Species: Hu, Mu, Rt, Po, Av, Bv, Fi, Gt, Ma, Re
Applications: WB, ELISA, IHC
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-15275
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83224
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029883-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for BTG3 Antibody (NBP1-89098)(1)

Reviews for BTG3 Antibody (NBP1-89098) (0)

There are no reviews for BTG3 Antibody (NBP1-89098). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BTG3 Antibody (NBP1-89098) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BTG3 Products

Bioinformatics Tool for BTG3 Antibody (NBP1-89098)

Discover related pathways, diseases and genes to BTG3 Antibody (NBP1-89098). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BTG3 Antibody (NBP1-89098)

Discover more about diseases related to BTG3 Antibody (NBP1-89098).
 

Pathways for BTG3 Antibody (NBP1-89098)

View related products by pathway.

PTMs for BTG3 Antibody (NBP1-89098)

Learn more about PTMs related to BTG3 Antibody (NBP1-89098).
 

Research Areas for BTG3 Antibody (NBP1-89098)

Find related products by research area.

Blogs on BTG3

There are no specific blogs for BTG3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BTG3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BTG3