BTG3 Antibody

Western Blot: BTG3 Antibody [NBP1-89098] - Analysis in control (vector only transfected HEK293T lysate) and BTG3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: BTG3 Antibody [NBP1-89098] - Staining of human pancreas shows distinct cytoplasmic positivity in exocrine glandular cells along with extracellular material.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

BTG3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VDPCEVCCRYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVT
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BTG3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  BTG3 Protein (NBP1-89098PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23657964)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BTG3 Antibody

• Abundant in neuroepithelium area protein
• ANATOB55
• B-cell translocation gene 3
• B-cell translocation gene10
• BTG family member 3
• BTG family, member 3
• MGC8928
• protein BTG3
• Protein Tob5
• tob55
• TOB5TOFA

Background

The protein encoded by the BTG3 gene is a member of the BTG/Tob family. This family has structurally related proteins thatappear to have antiproliferative properties. This encoded protein might play a role in neurogenesis in the centralnervous system. Two transcript variants encoding different isoforms have been found for this gene. (provided byRefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for BTG3 Antibody (NBP1-89098)(1)

Publication using NBP1-89098

• Deng B, Zhao Y, Gou W et al. Decreased expression of BTG3 was linked to carcinogenesis, aggressiveness, and prognosis of ovarian carcinoma. Tumour Biol 2013-10-01 [PMID: 23657964]

Bioinformatics

• Gene Symbol: BTG3