CNOT2 Antibody


Western Blot: CNOT2 Antibody [NBP2-56034] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: CNOT2 Antibody [NBP2-56034] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CNOT2 Antibody [NBP2-56034] - Immunohistochemical staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

CNOT2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DGSENVTGLDLSDFPALADRNRREGSGNPTPLINPLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPT
Specificity of human CNOT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CNOT2 Recombinant Protein Antigen (NBP2-56034PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for CNOT2 Antibody

  • CCR4-associated factor 2
  • CCR4-NOT transcription complex, subunit 2
  • CDC36FLJ26456
  • negative regulator of transcription 2
  • NOT2CCR4-NOT transcription complex subunit 2
  • NOT2H


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, CyTOF-reported
Species: Hu, Mu, Rt, Bv, Ch, Xp
Applications: WB, IHC-P
Species: Hu
Applications: WB, ICC/IF, IP, KO
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF, KO
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
Species: Hu, Pm
Applications: Flow, IHC, IHC-P, IP, Flow-CS
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP

Publications for CNOT2 Antibody (NBP2-56034) (0)

There are no publications for CNOT2 Antibody (NBP2-56034).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNOT2 Antibody (NBP2-56034) (0)

There are no reviews for CNOT2 Antibody (NBP2-56034). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CNOT2 Antibody (NBP2-56034) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for CNOT2 Antibody (NBP2-56034)

Discover related pathways, diseases and genes to CNOT2 Antibody (NBP2-56034). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNOT2 Antibody (NBP2-56034)

Discover more about diseases related to CNOT2 Antibody (NBP2-56034).

Pathways for CNOT2 Antibody (NBP2-56034)

View related products by pathway.

PTMs for CNOT2 Antibody (NBP2-56034)

Learn more about PTMs related to CNOT2 Antibody (NBP2-56034).

Blogs on CNOT2

There are no specific blogs for CNOT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CNOT2 Antibody and receive a gift card or discount.


Gene Symbol CNOT2